(data stored in ACNUC7421 zone)

EMBL: CP000075.PE250

CP000075.PE250       Location/Qualifiers
FT   CDS_pept        complement(263604..263987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35323"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35323.1"
FT                   /translation="MQRFPASLWSISMPNLEAVTLPSQRPDSWSSSNAQCCARYRVCAE
FT                   AEPALLCQVLNLFAMQYLIPDQLSAVQQESLLLIDLQVSRLSWHRAQVIGEKMRNLIDV
FT                   CSVEVEQVDARNTAQSRAALATG"
     atgcaaagat ttccagcatc cttgtggagt atcagcatgc ccaatctcga agccgtcacc        60
     ctcccttcgc agcgtccaga tagctggtcg tccagcaatg cgcagtgctg cgcacgctac       120
     cgtgtctgcg ccgaagccga gcctgccttg ctctgtcagg tgttgaacct gtttgccatg       180
     cagtacctga ttcccgacca attgagtgct gtgcaacaag agagcctgct gctcatcgac       240
     cttcaggttt ccagattgag ctggcatcga gcacaggtga ttggcgaaaa aatgcgcaac       300
     ctgatcgacg tctgctcagt ggaagtcgag caggtcgacg cccggaacac cgcgcaatcc       360
     cgtgccgccc tggcgacggg ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page