(data stored in ACNUC7421 zone)

EMBL: CP000075.PE259

CP000075.PE259       Location/Qualifiers
FT   CDS_pept        275025..276347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0259"
FT                   /product="Osmolarity sensor protein envZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35332"
FT                   /db_xref="GOA:Q4ZZU0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35332.1"
FT                   /translation="MAAVMKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVL
FT                   VDRQYSHGVALTLRAYWAAGENDREAIAEAAGLIRVVGGGVPEGEQHWPYSEIYQRQMQ
FT                   AELGADTEVRLRVHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLS
FT                   TASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPVSDTPSEMTEVYRAFNQMAEDVEQA
FT                   GQERELMLAGVSHDLRTPLTRLRLSLELMNDNEFSEGMVRDIEDMDAILDQFLAFIRDG
FT                   RDEEIEEVDLGHLVRDVVAPFNDDEDSIRLCLEPIPPFPLRRVSMKRLLTNLIGNAKHH
FT                   AGNGIEVAAYVSGDRNAPYVVLSVLDRGAGIDPSELDTIFNPFIRGDRARSGKGTGLGL
FT                   AIVKRIAAMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAI"
     atggctgcag ttatgaagac tccgctctgg ttcccgcaaa gctttttctc ccgcacgctc        60
     tggctggtgc tcatcgtcgt gctgttttcc aaggccctga cgctggttta tctgctgatg       120
     aacgaagacg tgctggtcga caggcaatac agccacggtg ttgctctgac cttgcgcgcg       180
     tactgggccg ccggtgaaaa cgatcgcgag gcgattgccg aggcggcggg cctgattcgg       240
     gtagtgggcg gtggcgtgcc ggaaggcgag cagcactggc cctacagtga gatctatcag       300
     cgacagatgc aggccgagct gggtgccgat acggaagtgc gtctgcgcgt acacgcgccg       360
     cccgcgctgt gggtgcgagc gccgagcctg ggtgacggct ggctgaaagt gccgctgtat       420
     ccgcacccgt tgcgcggtca gaaaatctgg aacgtgctgg gctggttcct ggccatcgga       480
     ttgctctcca cggcatcagc ctggattttc gtacgccagt tgaatcagcc gctcaagcgt       540
     ttggtgtttg cggcgcgcca gttggggcag gggcgcagcg tacggctgcc ggtgagtgac       600
     acgccgagcg agatgaccga agtctaccgg gccttcaatc agatggccga agacgtcgag       660
     caggccgggc aggaacgcga gttgatgctg gccggtgttt cccacgactt gcgcacgccg       720
     ctgacgcgcc tgcgcctgtc tctggagctg atgaacgaca atgagttctc cgaaggcatg       780
     gtgcgcgata tcgaggacat ggacgccatt ctcgatcagt tcctggcctt catccgcgat       840
     gggcgcgacg aagagatcga agaggtcgat ctggggcatc tggtacgcga tgtggttgca       900
     cctttcaatg acgatgaaga cagcatccgt ctgtgcctgg agcccattcc gcccttcccg       960
     ttacgccgcg tgtcgatgaa gcgcctgctg accaacctga ttggcaatgc caagcaccat      1020
     gccggtaacg gtatcgaagt cgccgcctac gtatccggcg accgaaacgc gccctacgtg      1080
     gtgttgagcg tgctggaccg gggggcgggc atcgatccgt ccgagctgga caccatcttc      1140
     aacccgttca ttcgcggtga tcgcgcacgc agtggcaagg gcaccggcct cggcctggcc      1200
     atcgtcaagc gtatcgctgc catgcacggc ggcaacgtcg agttgagaaa tcgttcggga      1260
     ggcggactgg aagcacgcgt aaggctgccg ctggggctga tgctgccgag agatgcaatt      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page