(data stored in ACNUC7421 zone)

EMBL: CP000075.PE260

CP000075.PE260       Location/Qualifiers
FT   CDS_pept        complement(276603..277070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35333"
FT                   /db_xref="GOA:Q4ZZT9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35333.1"
FT                   /translation="MHTSFRTLAAALLMGGSAMVMAANDGQSRVNELLSSAPEYRTTWA
FT                   KVVKKEERLPDWVINLSGASGQQMTAATEDGDNYLVGPLCETADTCKSKRLIVAFSLDK
FT                   EDAYAMLVEVPAGLPADKSPTRHATYRYLGKPDEGMQKLLNEELRKDPNWY"
     atgcacacgt catttcgcac actggccgcc gccctgttga tgggcggtag tgccatggtc        60
     atggcagcca atgatggaca gtctcgggtc aatgagcttc tgagctccgc gcccgagtac       120
     cgcaccacct gggcgaaggt cgtcaagaag gaagagcgtt tgccggattg ggtgatcaac       180
     ctgtccggtg cttccgggca gcagatgaca gcggccactg aagacggtga caactatctg       240
     gttggaccgc tttgcgaaac ggccgatacg tgcaaaagca agcgcctgat cgtggctttc       300
     agcctcgaca aggaagatgc ttacgccatg ttggttgaag tgcctgccgg tcttcctgca       360
     gacaaatcgc caacacgtca cgcgacttac cgttacctgg gtaagcctga cgagggtatg       420
     caaaagctct tgaatgaaga gctgcgcaaa gacccgaact ggtattga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page