(data stored in ACNUC7421 zone)

EMBL: CP000075.PE261

CP000075.PE261       Location/Qualifiers
FT   CDS_pept        complement(277295..277582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35334"
FT                   /db_xref="GOA:Q4ZZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35334.1"
FT                   /translation="MNSQRIAQLRISPLHIQQGLFLLLALLVTLIAIQQFQRWNQANEA
FT                   AQPKQQFIQTSSISYRGVSAPAVKDMSSSLRNVDGLVSVDEVAPQQKWVF"
     atgaacagcc agcgtattgc acaattgcgt atctctcccc tgcatatcca gcaaggtctt        60
     tttctgctcc ttgccttgct cgtcactctg atcgccattc agcagttcca gcgttggaat       120
     caagccaacg aggcagctca accgaaacag caattcatcc agaccagcag catctcctat       180
     cgcggtgtta gtgcaccagc agtcaaggac atgtcctcaa gcctgcgcaa tgtcgacggc       240
     ctggtttctg tagatgaagt cgctccacag caaaaatggg ttttctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page