(data stored in SCRATCH zone)

EMBL: CP000075.PE262

CP000075.PE262       Location/Qualifiers
FT   CDS_pept        complement(277811..278650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0262"
FT                   /product="Transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35335"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35335.1"
FT                   /translation="MFSLKKIALITAAAALLGSGPVLAQPDLPAQLTEARQEGSIWTAF
FT                   ALNKHLSPFKIDVGVEQGTATLKGKVENEVDRELAERIALDTKGIEKVDNQLEVDPSVA
FT                   SEPGTRTNMAQRFEDATLVATVKSKLLWSSVTEALNIEVDSKDGVITLKGRAQSPEAKE
FT                   LAGSLASNTDGVVSVNNLISLSAADSIAAKAQPQSLTPTEEMSDAWITSKVKASLIYSR
FT                   TLDGLNIKVDTKAGVVSLNGVVANFAEKELAVEIAKNIRGVKGVNGDALKVMARSAG"
     atgttttcac tgaaaaagat tgctctgatc acggccgccg ctgcgctgct gggcagcggc        60
     ccggtactcg cccagcctga cctgcctgct cagctcaccg aggcgcgtca ggaaggttcg       120
     atctggacag ctttcgcgct gaacaagcat ctgagcccgt tcaagatcga tgtgggtgtc       180
     gaacaaggca ctgcgacact caagggcaag gttgaaaacg aggtggaccg cgaactggcc       240
     gagcgcatcg cgctggatac caaaggcatc gagaaggtcg acaatcagct ggaggtggac       300
     ccttctgtcg ccagcgagcc tggcacccgg accaacatgg ctcagcggtt cgaagatgcg       360
     acgctggtcg cgacggtgaa atccaagctg ctgtggagca gcgtgaccga agcgctgaat       420
     atcgaagtcg acagcaagga cggcgtcatc accctcaagg gccgagcgca aagccccgaa       480
     gcgaaggaac tggccggtag cctggccagc aacaccgatg gcgtggtcag cgtcaacaac       540
     ctgatcagcc tcagcgcggc cgattcgatt gccgccaagg cccagccaca atctctgacc       600
     ccgaccgagg aaatgagcga tgcctggatc accagcaagg tcaaggcaag cctgatctat       660
     agccgaacgc tggatgggct gaacatcaaa gtggacacca aggccggtgt tgtcagcctg       720
     aatggcgtgg tcgccaactt cgccgagaaa gaactggcgg tggaaatcgc gaaaaatatt       780
     cgtggtgtca aaggcgtcaa cggcgacgcg ctgaaggtca tggcgcgcag cgcaggctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page