(data stored in ACNUC7421 zone)

EMBL: CP000075.PE27

CP000075.PE27        Location/Qualifiers
FT   CDS_pept        complement(31284..31601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35101"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35101.1"
FT                   /translation="MKRSLIPLSLALILSASFASAGSWPPETSAKVPGNALEYPTKLEA
FT                   VNVSMEEMLNAGATVVSSYVADIGPVVTLKNKKHYVICMLRGAGTGSDTNVATSKCYAM
FT                   N"
     atgaaaaggt cacttatacc cctctcgctg gccctgattc tgagcgcatc ctttgcctct        60
     gcgggtagct ggccaccaga aaccagcgcc aaagtgcctg gaaacgcgct ggaatatccg       120
     accaagctgg aggccgtcaa tgtctctatg gaagaaatgc tcaatgcagg agcaacggtc       180
     gtttcttcgt acgtggcaga cattggtccg gtagtgaccc tcaagaacaa gaaacactat       240
     gttatctgca tgctcagagg tgctggaacc gggtcagata caaacgtcgc cacctcgaaa       300
     tgctacgcca tgaactag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page