(data stored in ACNUC7421 zone)

EMBL: CP000075.PE271

CP000075.PE271       Location/Qualifiers
FT   CDS_pept        290530..290817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35344"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35344.1"
FT                   /translation="MCKVNRLILTGLLAFCPLLAVAAEDPPSAAPDVTIRTDGDRTIQE
FT                   YRQNGFLYAVKITPKHGKPYFLVRADGTSPNFIRSDQPDMLIPQWEIFSW"
     atgtgcaagg taaatcgact gatattgacc ggcctgttgg cattttgccc tttgctcgct        60
     gttgcagcag aagatccacc ttcagcggcg ccggacgtta ctattcgcac tgacggtgac       120
     agaaccattc aggaataccg ccagaatggc tttttgtatg cggttaaaat caccccgaaa       180
     cacggcaaac cctattttct ggtgcgcgcc gatggtacaa gccccaattt cattcgttcg       240
     gaccaaccgg acatgctgat cccgcagtgg gaaatattca gctggtag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page