(data stored in ACNUC7421 zone)

EMBL: CP000075.PE272

CP000075.PE272       Location/Qualifiers
FT   CDS_pept        290854..291804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0272"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35345"
FT                   /db_xref="GOA:Q4ZZS7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35345.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDYQGIAAGSENTNYFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHEADLPVPYALRTTDGQALRELADKPALLQPRL
FT                   PGKHISEPNTQHCVQIGELLANLHLATRGQIVERKTDRGLDWMLSEGRNFLSHLGETQR
FT                   ALLEKSLQEIEACKPQIMALPRANLHADLFRDNVLFEGTHLTGLIDFYNACSGPMLYDL
FT                   AITLNDWCSRENGQLDAVRARALLGAYAGLRPFTAAESKLWATMLRIACVRFWLSRLIA
FT                   AETFAGQDVLIHDPAEFERRLAERQEAHIALPFAL"
     atgtccgttt ttaccccact ggctcggccc gagctggaaa catttctcgc cccttacggg        60
     ctcggccgtc tgcttgacta tcagggcatc gctgccggta gtgaaaacac caattacttc       120
     atcagtctgg agcagggcga gttcgtgctg actttggtcg agcgcggccc ggttcaggag       180
     atgccgttct tcatcgagct gctcgacgtg ctgcatgaag ccgatctgcc ggtgccttat       240
     gcgctgcgca ccaccgacgg tcaggcgctg cgcgagctgg cagacaagcc ggcgcttttg       300
     cagccgcgtc tgccgggcaa gcacatcagt gagccgaaca cccagcactg cgtgcagatt       360
     ggcgagttgc tggccaacct gcatctggcg acccgcgggc agatcgtcga gcgcaagact       420
     gatcgcggtc tggactggat gctgagcgag gggcgcaatt ttctgtcgca cctgggcgag       480
     acgcagcgag cgctgcttga aaagagcctt caggagatcg aggcgtgcaa accgcagatc       540
     atggcgctgc cgcgcgccaa tctgcatgcc gatctgttcc gcgacaacgt actgttcgaa       600
     gggacgcacc tgaccgggtt gatcgatttc tacaatgcct gctcgggtcc gatgttgtac       660
     gacctggcga ttaccctcaa cgactggtgt tcccgcgaaa acggtcagct cgatgctgtc       720
     cgcgcgcgcg ccttgctggg ggcctatgca ggcttgcgac cgttcacggc tgcggagtcg       780
     aagctctggg cgaccatgtt gcgtatcgct tgtgtgcgtt tctggctgtc acgtttgatc       840
     gccgctgaaa ccttcgccgg tcaggatgtg ctgattcatg atcctgcgga gttcgagcgc       900
     cgcctggccg agcgccagga agcgcatatt gcgttgccgt ttgcgctctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page