(data stored in ACNUC7421 zone)

EMBL: CP000075.PE273

CP000075.PE273       Location/Qualifiers
FT   CDS_pept        complement(291899..292735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0273"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35346"
FT                   /db_xref="GOA:Q4ZYW0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZYW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35346.1"
FT                   /translation="MELRPLHPLDGLLKFAGLARSTFYYQQKVLLVDDKYAGLKDLIQA
FT                   TFYEHKGRYGYRRITAALRRAGHLVNHKTVQKLMGQLGLKSLIRVKKYRSYKGETGKAA
FT                   PNLLKRDFKAQYLNQKWATDVTEFKVGGQKLYLSPIMDLYSGEIISYAIARRPLYSMVD
FT                   EMLEGAFKRLGPHEKPILHSDQGWQYRMPIYQRLLNENSIAASMSRKGNCYDNAAIESF
FT                   FSTLKSEFFYLNKFNDLDELQAGIEEYIEYYNHSRIKLKLNGLSPVEYRMQAAKAA"
     atggaactga ggcctttaca tcctctggac ggcctgctga agtttgccgg tctggcacgc        60
     agcacttttt actatcaaca aaaggtactg ctggtagatg acaaatacgc cgggctgaaa       120
     gacctgattc aggcaacttt ctacgagcac aagggccggt atggctatcg tcgcatcacg       180
     gcagctttgc gcagggcggg ccatcttgtg aaccacaaga cggtgcagaa actaatgggg       240
     cagctaggcc tgaagagcct gatacgcgtg aagaaatacc gttcctacaa aggcgaaaca       300
     ggcaaggccg cgcctaacct gctaaagcgt gatttcaaag cgcaatacct taaccagaaa       360
     tgggccaccg acgtgaccga attcaaagta ggaggccaga aactttatct gtcgccgatc       420
     atggatctgt acagcggcga aatcatttcc tatgcgattg ccaggcgccc gctgtactcc       480
     atggtcgacg aaatgcttga aggagcattt aagcggcttg gaccgcatga aaagccgatt       540
     ttgcattccg accagggctg gcaatatcgg atgcctattt accagcgact gctcaatgag       600
     aattcgatcg cagccagcat gtcgcgcaag ggtaactgct acgacaacgc ggctattgag       660
     agctttttta gcacgctgaa atccgaattt ttctacctga acaaatttaa cgatctggat       720
     gagcttcaag cgggtatcga agagtacatt gagtattaca atcactcacg cataaaactg       780
     aagcttaacg gcctgagtcc tgtggaatac agaatgcagg ccgccaaggc agcgtag          837
//

If you have problems or comments...

PBIL Back to PBIL home page