(data stored in SCRATCH zone)

EMBL: CP000075.PE275

CP000075.PE275       Location/Qualifiers
FT   CDS_pept        complement(293509..294450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0275"
FT                   /product="Periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35348"
FT                   /db_xref="GOA:Q4ZZS4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35348.1"
FT                   /translation="MRRLLNLAAVFWVSLLIISPAQAEVRVLTSIKPLQLIAAAVQDGV
FT                   GTPEVLLPPGASPHNYALRPSDVRRVQEVELLYWIGPDMETFLPRVIQGRKLPAVAVQT
FT                   LPGMHLRHFGEDNASHDDHEHDHDNDADEHDHDHRPGSLDSHLWLSTVNARVIAAKMAT
FT                   DLSAADPANAARYASNAEAFSKRLDTLDARIKQRVSTVAGKPYFVFHEAFDYFEEAYGL
FT                   KHAGVFAIAAEIQPGAQHVAAMRERLKAAGKTCVFSEPPLRPRLAETLSAGLPVKLAEL
FT                   DALGGYTPATAQGYEQVLQKLADDLAGCLSSL"
     gtgcgccgtc ttttaaatct tgctgctgtt ttctgggtca gcctgctgat catctcccct        60
     gctcaggccg aggtccgggt gctgaccagc atcaagcctc tgcagctgat tgcggcggct       120
     gtacaggatg gcgtcggtac accggaagtg cttctgccgc cgggtgcctc accgcataac       180
     tacgcgctgc gcccgtccga cgtacggcgt gtacaggaag tcgagttgct ctactggatc       240
     ggcccggaca tggaaacctt cctgccgcgc gtcattcagg gccgcaaact gcctgcggtt       300
     gccgtacaga cactgccggg catgcacttg cggcactttg gcgaagacaa cgcctcgcat       360
     gatgaccacg agcatgatca cgacaacgac gcagacgaac atgaccacga ccaccgcccc       420
     ggcagtctcg attcgcacct gtggctgtcg accgtcaacg cgcgggtgat cgccgcaaaa       480
     atggccactg acctgagcgc tgccgacccc gccaacgcag cccgctacgc cagcaacgcc       540
     gaggcgttca gcaaacgtct ggatacgctg gacgcccgta tcaagcagcg tgtcagcaca       600
     gtggcaggca agccttactt cgtattccac gaagccttcg attatttcga agaggcctat       660
     gggctcaagc atgccggggt attcgccatc gccgccgaga tccagcccgg cgcccagcac       720
     gtcgccgcca tgcgcgaacg cctgaaagct gcaggcaaga cctgcgtatt cagcgaaccg       780
     cccctgcgcc cgcgcctggc cgaaaccctg agcgccggcc tgccggtcaa actggccgaa       840
     ctggatgcac tgggcggcta caccccggcc accgcgcagg gttacgagca agtcctgcaa       900
     aagctcgccg acgacctggc aggttgcctg agtagtctct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page