(data stored in SCRATCH zone)

EMBL: CP000075.PE276

CP000075.PE276       Location/Qualifiers
FT   CDS_pept        294518..295000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0276"
FT                   /product="zinc uptake regulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35349"
FT                   /db_xref="GOA:Q4ZZS3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35349.1"
FT                   /translation="MPNTPLASRPHDHSHCVHSALAEADALCAKQGLRLTTLRRRVLEL
FT                   VWQSHKPLGAYDILAVLSDEDGRRAAPPTVYRALDFLLENGLVHRIASLNAFTGCNHPT
FT                   HAHQGQFLICRLCHAAIELQHPAISNAVVDAAAGVGFAVEGQTVEIVGVCAGCKAA"
     atgcccaata ctcccctggc cagtcgcccc catgaccact ctcactgcgt gcattcggcc        60
     ctcgccgaag ccgatgcgct atgtgccaaa cagggtctgc gcctgaccac cttgcgccgt       120
     cgtgtgctgg aactggtctg gcaaagccac aagccgctgg gtgcctacga catccttgcg       180
     gtactgagtg atgaggacgg tcgccgtgcg gccccgccaa cggtttaccg tgcgctggat       240
     tttctcctgg aaaacggtct ggtgcaccgg attgcctcac tcaacgcctt cacgggctgc       300
     aaccacccca ctcatgcgca tcagggccag ttcctgatct gccgcctgtg tcatgcggcg       360
     atcgagctgc agcacccggc catcagcaat gccgtggtcg atgccgccgc aggcgtcggc       420
     ttcgcggtcg aaggccagac ggtcgagatc gtcggcgtat gcgctggctg caaggccgcc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page