(data stored in ACNUC7421 zone)

EMBL: CP000075.PE285

CP000075.PE285       Location/Qualifiers
FT   CDS_pept        complement(303388..303879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0285"
FT                   /product="Cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35358"
FT                   /db_xref="GOA:Q4ZZR4"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35358.1"
FT                   /translation="MSQPLLSKRLVLRLTCLIVIMLIGGLALPSLYGVLTGHDNALPGE
FT                   DASRQVEVQFTASNVAGMTWAFYPQASQMQVHPGTVNEMIFIAQNPTDRPMKAQAVPGI
FT                   SPGKAAAWFHKTECFCFTQQTLQPGERIEMPVRFIIDRDMPDDVKHLTLAYTLFDVTTP
FT                   "
     atgagccagc ctcttttgtc caaacggctc gtcctgcgtt tgacgtgctt aatagtgatc        60
     atgctgatag gtggattggc attgccgtcg ctctatggcg tgctgaccgg acatgacaat       120
     gccctaccgg gtgaggacgc ttcgcgccag gtcgaagtgc agttcaccgc cagcaacgtt       180
     gccgggatga cctgggcgtt ttatccacag gccagccaga tgcaggtcca tcccggcacg       240
     gtcaacgaga tgatcttcat cgcgcagaac ccgaccgaca gaccgatgaa agcccaggcc       300
     gtcccgggta tttcacccgg aaaagcggct gcgtggtttc acaagaccga atgtttctgc       360
     ttcacgcaac agacattgca gccgggcgag cgcatcgaga tgccggtacg cttcatcatc       420
     gaccgggaca tgcccgacga tgtaaaacac ctgacgctgg cctatacgct gttcgatgtc       480
     accacgccct ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page