(data stored in ACNUC7421 zone)

EMBL: CP000075.PE286

CP000075.PE286       Location/Qualifiers
FT   CDS_pept        304127..304777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35359"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35359.1"
FT                   /translation="MNTAALREQIQLAHQHEARTGHLLQQLAQKLPHLHPAIHLPEVDA
FT                   KDVLARFVTAYIDLVPDLLDAAHEVALEAGIEGQIKPVLKIAEHFFAAPPSIMDGHEGL
FT                   ESLLDEAYLAHRLVEEVNDLYIKHFGQPLIPSNTTVASVIAHQLIGEQFANQLDEAVHH
FT                   AVDELLDEESFALDSVEAYREKLISPETGAAWQRWPSLSRQLGVGLELERSAV"
     atgaacaccg ccgcattgcg cgagcagata caactagccc atcaacatga ggcccggacc        60
     ggccacttgc tgcaacagtt ggcacaaaag ctcccacatc tccatcctgc catccacctg       120
     ccggaagtcg atgcgaaaga tgttctggcg cgcttcgtca cggcctacat cgatctggta       180
     cccgatctgc tggacgcagc tcatgaggtc gcgctggaag ccgggatcga aggtcagata       240
     aagccggtgc tgaaaatcgc cgagcatttt ttcgcggccc caccttccat catggatggg       300
     catgaaggcc tggaaagcct gctggacgag gcttatctgg cccaccggtt ggtcgaggaa       360
     gtgaatgacc tgtacatcaa gcatttcggt cagccgctga taccgtcaaa taccacggtt       420
     gccagcgtga ttgcccacca gttgatcggc gagcagtttg ccaaccagct ggacgaagcg       480
     gttcaccatg ccgtcgacga gttgcttgat gaagagagtt tcgcgctgga ctcggtcgag       540
     gcctaccgcg agaagctgat cagccctgaa acaggagcgg cttggcagcg ctggccaagc       600
     ctgtcacggc aattgggcgt cggcctggag ctggagcgct ccgcggtctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page