(data stored in ACNUC7421 zone)

EMBL: CP000075.PE293

CP000075.PE293       Location/Qualifiers
FT   CDS_pept        311440..313650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0293"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35366"
FT                   /db_xref="GOA:Q4ZZQ6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35366.1"
FT                   /translation="MNTEALIEAAVQVDVPEATPVVEPDIEVIPAIEAPAAVVPAIVAP
FT                   NLDDSSLYIHRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLK
FT                   KQITFAREQAGADGLQPHQALARISELVHGHVDRQYAILNDILLPELEKHQVRFIRRRH
FT                   WTAKLKAWVRRYFRDEIAPIITPIGLDPTHPFPLLVNKSLNFIVELEGIDAFGRDSGLA
FT                   IIPAPRLLPRVIKVPEEVCGPGDNFVFLSSMIHAHADDLFQGMKVKGCYQFRLTRNADL
FT                   ALDSEDVEDLARALRGELFSRRYGDAVRLEVADTCPKHLSDYLLKQFNLHESELYQVNG
FT                   PVNLTRLFSITGLDSHPELQYPPFTPAIPKLLQNSENVFSVVSKQDILLLHPFESFTPV
FT                   VDLLRQAAKDPHVLAVRQTLYRSGANSEIVDALVDAARNGKEVTAVIELRARFDEESNL
FT                   QLASRLQAAGAVVIYGVVGFKTHAKMMLILRREAGEIVRYAHLGTGNYHAGNARLYTDY
FT                   SLLTSDDALCEDVGKLFSQLIGMGKTLRMKKLLHAPFTLKKGMLDMIARETQFALDGKP
FT                   AHIIAKFNSLTDPKIIRALYKASQSGVRIDLVVRGMCCLRPGIAGVSHNIHVRSIIGRF
FT                   LEHTRVFYFLNGGDEQMFLSSADWMERNLDKRVETCFPVEGKKLILRVKKELESYLTDN
FT                   THSWLLQSDGRYVRSTPTGNQNPRSAQATLLERLSNPVLSVR"
     atgaataccg aagcactcat cgaagccgct gttcaagtcg atgtcccgga ggcaacgccc        60
     gtggtcgaac ctgacatcga agtaatcccg gccatcgagg cacccgccgc tgtggtgccc       120
     gctatcgtcg cgcccaacct ggacgacagc agcctgtata tccaccgtga actgtcgcaa       180
     ctgcagttca atatccgggt tctggaacag gcgctcgatg agtcctaccc gttgctggag       240
     cggctgaagt ttctgctgat cttctccagc aacctcgatg agttcttcga gattcgtgtt       300
     gcaggcctga agaagcagat cacctttgcc cgtgaacagg cgggcgccga cggtctgcag       360
     ccgcatcagg cgctggccag gatcagcgag ctggtccacg gtcatgtgga tcgtcagtac       420
     gcgatcctca acgacattct gctgccggag ctggagaaac atcaggtccg cttcattcgt       480
     cgccgtcact ggacggccaa gctcaaggcc tgggtacgac gctacttccg cgacgagatc       540
     gcgccgatca tcaccccgat cggtctcgac ccgacgcacc cgttcccgtt gctggtcaac       600
     aagagcctga acttcatcgt cgagcttgaa ggtatcgatg ccttcgggcg cgactccggt       660
     cttgcgatca ttcccgcgcc gcgtctgctg ccgcgtgtga tcaaggtgcc ggaagaggtc       720
     tgcgggcctg gcgataactt cgtgttcctg tcgtcgatga tccacgccca cgctgacgat       780
     ctgtttcagg gcatgaaggt caagggctgc taccagttcc gcctgacccg aaacgctgac       840
     ctggcgctgg actccgaaga tgtggaagac ctggcgcgcg cactgcgtgg cgagctgttc       900
     tcgcgtcgct atggtgatgc ggtacgtctg gaagtggcgg acacctgccc gaaacacctg       960
     tcggactacc tgctcaagca gttcaacctg cacgagtccg agctgtatca ggtgaatggc      1020
     ccggtcaacc tgacgcgtct gttcagcatc accggcctgg acagccaccc cgaattgcaa      1080
     tacccgccgt tcacgccagc catccccaag ctgctgcaga acagcgaaaa cgttttcagc      1140
     gtggtcagca agcaggacat cctgttgctg caccctttcg agtcgttcac gccggtggtc      1200
     gacctgctgc gccaggcggc aaaagatccg cacgtgctgg cggtacgcca gacgctgtat      1260
     cgcagcggcg cgaactcgga aatcgtcgat gcgctggtcg atgccgcgcg taacggcaag      1320
     gaagtcactg cggtgatcga gttgcgtgcg cgtttcgacg aagagtccaa cctgcaactg      1380
     gccagccgcc tgcaggccgc cggtgcggtg gtgatctacg gcgtggtcgg cttcaagacc      1440
     cacgccaaga tgatgctgat cctgcgtcgc gaagccggcg agatcgtacg ttatgcgcac      1500
     ctcggcaccg gcaactacca cgccggtaac gcacgtctgt ataccgacta cagcttgctg      1560
     acctccgatg acgccctgtg cgaagacgtc ggcaaactgt tcagccagtt gatcggcatg      1620
     ggcaagacgc tgcgcatgaa gaagctgctg catgcgccgt tcacgctcaa gaaaggcatg      1680
     ctcgacatga tcgcccgcga gacgcaattt gcgctcgatg gcaaacctgc gcacatcatc      1740
     gccaagttca actcgctgac cgatccgaag atcatccggg cgttgtacaa ggccagccag      1800
     tccggtgtgc gcatcgatct ggtggtgcgc ggcatgtgct gcctgcgtcc gggcatcgcc      1860
     ggggtttcgc acaatatcca tgtgcgctcg atcatcggcc gcttcctgga gcacacgcgg      1920
     gtgttctact tcctcaatgg cggcgacgag cagatgttcc tgtcgagtgc cgactggatg      1980
     gagcgcaacc tcgacaagcg cgtcgagacc tgcttcccgg tggaaggcaa gaagttgatt      2040
     ctgcgtgtga agaaggagct ggaaagctac ctgaccgaca acacccacag ctggctgttg      2100
     cagtcggacg ggcgttacgt gcgcagcacg ccgaccggca accagaaccc gcgaagcgcc      2160
     caggcgaccc ttctggagcg cctgagcaac ccggtcctca gcgtacgctg a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page