(data stored in SCRATCH zone)

EMBL: CP000075.PE296

CP000075.PE296       Location/Qualifiers
FT   CDS_pept        complement(316532..317179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0296"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35369"
FT                   /db_xref="GOA:Q4ZZQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35369.1"
FT                   /translation="MDFTLWDIVRNLLIGLQWTVALSLVAFIGGGLIGLLIMGMRTSEK
FT                   SGPRVTAKLYIELFQGTPLLMQLFLVFFGVALMGLNISPWAAAALALTLFTSAYLAEIW
FT                   RGCVESISKGQWEASASLALTPFEQMRYVILPQALRIAVAPTVGFSVQVVKGTAVTSII
FT                   GFTELTKTGSMLANATFEPFMVYGFVALGYFILCYPLSLCARHLERRLHASA"
     atggatttca ccctctggga catcgtgcgc aatctgctga tcggcctgca atggaccgtg        60
     gccttgtcgc tggtggcgtt catcggcggc gggctgatcg gcttgctgat catgggcatg       120
     cgcacctcgg aaaaatccgg cccgcgcgtg accgccaaac tctatataga actgtttcag       180
     ggcacaccgc tgttgatgca gttgtttctg gtgttcttcg gtgtcgccct gatgggcctg       240
     aacatttcgc cctgggcggc ggcggcactg gccttgacgc tgtttaccag cgcctacctt       300
     gcggagatct ggcgcggctg tgtggagtcg atctccaagg gccagtggga agcatccgcg       360
     agcctggcgc tgaccccgtt cgagcagatg cgctatgtga ttctgccgca ggcgctgcgc       420
     atcgcggtcg cgccgacggt cggcttttcc gtgcaggtgg tcaaaggcac ggcggtgacg       480
     tcgatcatcg gcttcaccga attgaccaag accggcagca tgctggccaa cgccacgttc       540
     gaacctttca tggtctatgg cttcgttgcc ctgggctact tcatcctgtg ctaccccttg       600
     tcgctgtgcg cgcgccatct ggaaaggaga ctgcatgcct ctgcttag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page