(data stored in SCRATCH zone)

EMBL: CP000075.PE298

CP000075.PE298       Location/Qualifiers
FT   CDS_pept        complement(317876..318661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0298"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35371"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35371.1"
FT                   /translation="MTKRYSALLTALFASLMLSQTPAHANGLDDVVARGTLKVAVPQDF
FT                   PPFGSVGPDMKPRGLDIDTAQLLADKLKVKLELTPVNSTNRIPFLTTGKVDLVISSLGK
FT                   NPDREKVIDFSRAYAPFYLAVFGPPDSPVKDIADLKGKTISVTRGAIEDIELSNVAPEG
FT                   ATIKRFEDNNSTIAAYLAGQTDLIASGNVVMVAISERNPKRIPAMKVKLKDSPVYVGVN
FT                   KGQPELLGKVNEILNAAKADGTLEKASQKWLKDPLPADL"
     atgaccaagc gttacagcgc cctgcttact gcattgtttg ccagtctgat gctgagccag        60
     acacccgccc acgccaacgg cctggacgac gttgtagcgc gcggcaccct caaggtagcc       120
     gttccgcagg acttcccgcc attcggctcg gtcggcccgg acatgaagcc gcgcggcctg       180
     gacatcgata ctgcacagct gctggctgac aagctgaagg tcaagctgga gctgaccccg       240
     gtcaacagca ccaaccgcat tccgttcctg accaccggca aggtcgacct ggtgatctcc       300
     agcctgggca agaacccgga tcgcgagaaa gtcatcgact tctcgcgcgc ctacgcacct       360
     ttctatctgg cggtattcgg cccacctgat tcgccggtca aggacatcgc tgacctgaaa       420
     ggcaagacta tcagcgtgac ccgtggcgcg atcgaggata tcgagctgtc gaacgttgct       480
     cccgagggcg cgaccatcaa gcgctttgaa gacaacaact cgaccatcgc ggcctatctc       540
     gctggccaga ctgacctgat cgccagcggc aacgtggtga tggtcgccat cagtgagcgc       600
     aatcccaagc gcattccggc gatgaaagtg aaactcaagg actcgccggt gtacgttggc       660
     gtgaacaaag gtcagccaga actgctgggc aaggtcaacg agattctgaa cgctgccaag       720
     gctgacggta cgctggaaaa agcgtcgcag aaatggctga aggacccgct acccgccgat       780
     ctctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page