(data stored in ACNUC7421 zone)

EMBL: CP000075.PE3

CP000075.PE3         Location/Qualifiers
FT   CDS_pept        2701..3804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35077"
FT                   /db_xref="GOA:Q500U5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35077.1"
FT                   /translation="MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGIARSFRSSRLLPVIQYEQPSCTVFGQVDLAQGGHSNLGVSRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMATWQRLQKALKQRN
FT                   SWLRHGTLDAASQAAWDRELCSASDEIDEFRRAYIKALKPVFEQTLSELVELEGLTLSY
FT                   YRGWDKEKELSTVLASSIHRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQVRRGQCIYLVDDLPSELDDNHRRALCRLLEELRCQVFITCVDQEFLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
     atgtctctta gtcgcgtctc ggtcaccggg gtgcgcaatc tgcacccggt gaccctctcc        60
     ccctccccgc gtatcaatat cctctacggc gcaaacggca gtggcaaaac cagcgtgctg       120
     gaagctatcc atctgctggg cattgctcgc tcgttccgca gcagtcgcct gctgcccgtc       180
     attcagtacg agcagccttc ctgcaccgtc ttcggtcagg tcgatcttgc acaaggtgga       240
     cacagcaatc tgggtgtttc acgcgaccgc caaggcgagt tccagattcg tatcgatggg       300
     cagaacgcca gaagcgctgc gcagcttgca gaaattctgc cgctgcagct catcaacccc       360
     gacagcttcc gattgcttga aggtgcgccg aagatacgca ggcagtttct ggattgggga       420
     gtgttccacg tggaacctcg ctttatggcc acgtggcagc gcctgcagaa ggccctcaag       480
     cagcgaaact cgtggcttcg gcatggtaca cttgacgccg cttcacaggc ggcatgggac       540
     cgtgagctgt gctcggcaag tgacgagatc gacgagttcc gccgggctta tatcaaggca       600
     ttgaagccag tctttgaaca gactttgagc gaacttgttg agcttgaagg tttgaccctg       660
     agctactacc gaggatggga caaggaaaaa gagctaagta cagtgctcgc ctcttccatc       720
     caccgcgatc agcaaatggg ccacacccag gccggaccac agcgagctga tctgcgcctt       780
     agattaggcg cgcataatgc ggcagatatt ctgtctcgcg gtcagcaaaa gctggtggtc       840
     tgcgcactgc gtattgctca gggacatctg gtcagccagg tccgtcgcgg ccagtgtatt       900
     tacctggtag atgatttgcc ctccgaactg gatgacaacc atcgacgcgc gctttgccgc       960
     ttgctggaag aattacgctg ccaggtgttt atcacctgtg tagatcaaga atttttgagg      1020
     gaaggctggc agacggaaac gccagtcgct ttgttccacg tggaacaagg ccgtatcacc      1080
     cagacccacg accatcggga gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page