(data stored in ACNUC7421 zone)

EMBL: CP000075.PE304

CP000075.PE304       Location/Qualifiers
FT   CDS_pept        324350..325018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0304"
FT                   /product="ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35377"
FT                   /db_xref="GOA:Q4ZZP5"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35377.1"
FT                   /translation="MENPINELAAAVHDGLGLTYPPVIDMGPQLTREQLLASMNATMRR
FT                   HKGGPVWLFAYGSLIWRPECTAVESQRARVHGYHRGLYLWSHEHRGTPEVPGLVFGLDR
FT                   GGSCTGFAYRLPDECLEKSLLALWEREMPYPSYRPHWLNCRLEDGRKVQALGFVLERHL
FT                   PSYAGNLPDSVLSQVLASARGRYGTTREYVEQTAKALRSHAMPDLNLEARLKRCKSETA
FT                   "
     atggagaatc caatcaacga gttggccgct gcagtgcacg acggtcttgg cctgacgtat        60
     ccgcccgtta tcgatatggg cccacagctc acccgcgagc aactgctcgc atccatgaac       120
     gccaccatgc gtcgtcacaa gggcggcccg gtctggctgt tcgcctatgg ttcactgatc       180
     tggcgtcccg agtgcaccgc cgtggagagc cagcgcgccc gagtgcacgg ttatcaccgc       240
     ggactttacc tctggtcgca cgaacaccgt ggcacgccgg aagtgccggg gctggtattc       300
     ggtctggacc gtggcggttc atgcaccggc ttcgcgtatc gtctgccgga tgaatgcctg       360
     gaaaaatcac tgctggcctt gtgggagcgc gagatgccgt acccctcgta tcgcccgcac       420
     tggctcaatt gccgccttga agatggccgg aaggtacagg ccctgggctt tgtgctggag       480
     cggcatttgc ccagctacgc aggcaacctg ccggacagcg tgctgagcca ggtgctcgcc       540
     agcgccagag ggcgctatgg aaccacccgc gagtacgtcg agcagaccgc caaggccctg       600
     cgtagccacg ccatgccaga cctgaatctg gaggcgcggc tcaagcgctg caagtcagag       660
     actgcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page