(data stored in ACNUC7421 zone)

EMBL: CP000075.PE308

CP000075.PE308       Location/Qualifiers
FT   CDS_pept        complement(328687..329424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35381"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35381.1"
FT                   /translation="MEELHHHLQQLRGDLQAEIAAYVGDWSGMNYIEIADKHIHAANHL
FT                   ISSKRAHLQPGYIELANTPKENIRVAPGNGGLADLVAEARYFLDSILGLENFKRSIEDL
FT                   FARLLELDRQHAERLALEARAEEAARARAEAEEAARRLAEEQAAQQRAIEAAFQLAQRQ
FT                   VEEAEHALALRNAEEARAKEAESNRAIEMTFGPEASREIDNAIKVLRGTIEIAITDFSN
FT                   AISAHGALDMSQLEAIQNMSATH"
     atggaagaac tacatcatca cctgcaacaa ttacgtggcg atctacaagc cgagattgca        60
     gcttacgtcg gcgactggag cgggatgaac tatatagaaa tagccgacaa acacatacat       120
     gccgcaaacc atctgatcag cagtaaacga gcacatctgc agccgggata tatcgagctt       180
     gccaatacgc ctaaggaaaa catacgagtt gcgccgggga acggcggcct tgcggatttg       240
     gtagccgaag cgagatattt cttagacagc attcttggtt tggagaactt caagcgcagc       300
     atcgaagacc tatttgccag gctattagaa cttgatcgcc aacacgctga gcgccttgcc       360
     ctggaagccc gagccgaaga agccgcgcgc gcaagagccg aggcggaaga ggcggctcgc       420
     cgactcgcgg aagaacaggc tgcgcagcag cgagccatag aagcagcatt ccagcttgca       480
     cagcgtcagg tcgaagaagc cgagcacgca ttggccctac gcaacgccga ggaagctcgc       540
     gctaaagagg ccgaatccaa ccgagcgata gagatgacgt tcgggcctga ggcgtcgcga       600
     gaaatcgata atgcgatcaa ggtgctgaga ggcactatcg aaatcgcgat caccgacttc       660
     tcgaatgcga tcagcgctca cggggcgctt gacatgagtc agcttgaagc gattcaaaat       720
     atgagcgcga ctcactaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page