(data stored in ACNUC7421 zone)

EMBL: CP000075.PE309

CP000075.PE309       Location/Qualifiers
FT   CDS_pept        complement(329472..329744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0309"
FT                   /product="Colicin immunity protein/pyocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35382"
FT                   /db_xref="GOA:Q4ZZP0"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35382.1"
FT                   /translation="MIFKEKIEDYTEEEFLEFLKGLSSEYSQLHGDEFIKHMDRSVEHF
FT                   VKITEHPAQTDVIFYPEEGQEDTPEGILKVIKEWRAKNGKPGFKS"
     atgatcttta aagaaaagat agaagattat accgaagaag agttcctgga gtttttgaaa        60
     gggctctctt ccgaatacag ccaacttcat ggagatgagt ttattaaaca tatggatcgc       120
     tcagttgagc attttgtaaa aataacagaa cacccggcac aaacagacgt aatattttat       180
     cccgaagaag gccaggaaga tactcccgag ggcattctaa aagtaatcaa agaatggcga       240
     gcaaaaaatg gcaagccagg attcaaaagt taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page