(data stored in SCRATCH zone)

EMBL: CP000075.PE31

CP000075.PE31        Location/Qualifiers
FT   CDS_pept        35445..36269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0031"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35105"
FT                   /db_xref="GOA:Q500R7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35105.1"
FT                   /translation="MPDLLIDGKTLHYSDQGTGPVVLLGHSYLWDKAMWSAQIDTLASQ
FT                   YRVIVPDLWGHGDSSGFPEGTRNLDDLARHALALLDHLNIERCNIVGLSVGGMWGAIAA
FT                   LLAPERITGLVLMDTYLGKETEAKKAYYFSLLDKLEEVGTFPEPLLDIVVPIFFRPGID
FT                   PQLPVYRSFRAALAGMNAEQLRQSVVPLGRMIFGRDDRLGLIEQLNADTTLVMCGDADI
FT                   PRPPEETREMASLIGCPYVLVPEAGHIANLENPAFVSGALMTFLARVNQKQG"
     atgccggatc tactcatcga cggtaagaca cttcactatt ccgaccaagg caccggaccg        60
     gtggtattgc tcggtcacag ctatctctgg gacaaggcga tgtggagtgc acagattgat       120
     acgctggcca gccagtatcg ggtgatcgtg ccggatctgt ggggtcatgg cgattccagc       180
     gggtttcctg agggcactcg caatctcgat gatctggcgc ggcatgcgct ggcgctgctg       240
     gatcatttga atatcgagcg ttgcaacatc gtagggttgt cggtcggtgg catgtggggc       300
     gccattgctg cgctgctcgc gccagagcgc atcaccgggc tggtgttgat ggacacctac       360
     ctgggcaagg agaccgaggc caagaaagcc tactatttct cgttgctgga caagctggaa       420
     gaggtcggga cctttcctga gccgctgctg gatatcgtcg taccgatctt cttccgtccc       480
     ggtattgatc cgcagttgcc tgtgtacagg tcgtttcgtg cggcgcttgc cggcatgaat       540
     gccgagcagt tgcgtcagtc cgtcgtaccg ctgggaagga tgattttcgg tcgtgatgac       600
     cggctcggtt tgatcgagca attgaatgcc gacaccacgc tggtgatgtg tggcgatgca       660
     gacattccac gcccgcccga ggagacgcgt gagatggcca gcctgatcgg ctgcccttat       720
     gtgctggtgc ctgaggccgg gcatatcgcc aatctggaaa atccggcgtt cgtatcgggt       780
     gcgctgatga cgttcctggc gcgggttaac cagaagcagg gttga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page