(data stored in ACNUC7421 zone)

EMBL: CP000075.PE314

CP000075.PE314       Location/Qualifiers
FT   CDS_pept        334005..334412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0314"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35386"
FT                   /db_xref="GOA:Q4ZZN6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35386.1"
FT                   /translation="MKAWILMLLALSLPVMAQEEAKEEGGPPKAAYVSLTPPFVGNYAL
FT                   DGGPKLRVYKADIALRVTGADAEAAVKRNDALIRNQLVSLFTQQTVDSMSSAEAKENIR
FT                   QEALKQVQRVMNDEEGKPIVEDLLFNNFIVQ"
     gtgaaagcgt ggattctgat gttgctggcc ttgtcattgc ctgtcatggc gcaagaggaa        60
     gccaaggaag aaggcggccc gccaaaagcg gcgtatgtct cgctgacgcc tccgttcgtg       120
     ggtaactacg cactcgatgg cggccccaag ctgcgtgtct acaaggctga cattgccttg       180
     cgtgtaaccg gtgccgacgc cgaggccgcc gtgaagcgca atgacgcact gatccgcaat       240
     caactggtgt cgctgttcac tcagcagacc gtcgattcca tgagcagcgc cgaagcgaag       300
     gaaaacattc gtcaggaagc cctcaagcag gttcagcgcg tcatgaacga tgaagaaggc       360
     aagccgattg tcgaagactt gctgttcaat aacttcatcg ttcaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page