(data stored in ACNUC7421 zone)

EMBL: CP000075.PE315

CP000075.PE315       Location/Qualifiers
FT   CDS_pept        complement(334419..334868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0315"
FT                   /product="Protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35387"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35387.1"
FT                   /translation="MAYWLMKSEPDEFSISDLQRLGKARWDGVRNYQARNFLRTMAEGD
FT                   KFFFYHSSCPEPGIAGIGKVARSAYPDPTALDPQSHYHDAKATEEKNPWSAIDVEFVDI
FT                   FKHVLGLGYLKQQSQLEQLPLVQKGSRLSVMPVTAEQWAAILALR"
     atggcctatt ggctgatgaa gtccgagcct gatgaattct cgatcagcga cctgcaacga        60
     ctgggcaaag cgcgctggga cggagtgcgc aactatcagg cgcgcaattt tctgagaacc       120
     atggcagagg gcgacaagtt ctttttctat cactccagtt gccccgaacc gggcatcgcc       180
     ggtatcggca aagtcgccag gtcagcttat ccggacccca ccgcgctgga cccccagagc       240
     cactatcacg acgccaaggc cacggaggaa aagaatccgt ggagtgccat cgacgtcgag       300
     ttcgtggata tcttcaaaca cgtgctgggg ctgggttatc tcaagcaaca aagccagctg       360
     gagcaactgc ctctggtaca aaaaggcagc cggctctcgg tcatgccggt gaccgccgaa       420
     caatgggcgg cgatcctggc attgcgctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page