(data stored in ACNUC7421 zone)

EMBL: CP000075.PE316

CP000075.PE316       Location/Qualifiers
FT   CDS_pept        335062..335214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35388.1"
FT                   /translation="MKRKPDLLWILVILFGLGVVTTGYAQSLWSTKDDAPVEITQQQQK
FT                   VPGRH"
     atgaaacgca agcctgattt actctggatt ctggttattc tgtttggctt gggtgtcgtg        60
     acaaccggtt atgcacagag cttgtggtcc accaaggacg acgctcccgt cgagatcaca       120
     cagcagcagc aaaaagtccc cggcaggcat tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page