(data stored in ACNUC7421 zone)

EMBL: CP000075.PE32

CP000075.PE32        Location/Qualifiers
FT   CDS_pept        complement(36536..37066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35106"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35106.1"
FT                   /translation="MKLPNRFITGLGILMISASPLLQAAPPDQRGDGPDDNRGAQQPGP
FT                   QNDGGHNQRGNDRGPGNDNGRGPDKGPASQPGRQAHQDNRGGNRPPQDFGPVRETFQQH
FT                   RDVIGRGQPLPPGVHIAKGRPLPPGYGKRLDSRSLQYLPQYDGYEWRRLGTDVVLIAVG
FT                   SGIVYAILDGVLN"
     atgaaactgc caaaccgttt tatcaccgga ctgggtatct tgatgatcag cgccagtccg        60
     ctgctgcaag ctgcaccacc cgatcaacgc ggtgatggcc cggacgacaa ccgtggagcc       120
     caacagccgg gaccgcagaa cgacggtggg cataaccagc gtggtaatga ccgtggaccg       180
     ggcaatgaca atggcagggg tccggacaaa ggcccggcca gccaaccagg cagacaggcg       240
     catcaggaca accgtggcgg caaccgccca ccgcaggatt tcggcccggt acgcgagact       300
     ttccagcaac accgcgacgt catcggtcgg ggccagccat tgccgccggg cgtacacatc       360
     gccaagggcc gtccgttgcc ccctggttac ggtaaacgtc tggacagccg ctcgctgcaa       420
     tacctgccac agtatgacgg ctacgaatgg cgccgcctgg gcaccgacgt ggtgctgatc       480
     gccgtgggtt cggggattgt gtatgcgatt ctggacggtg tgttgaattg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page