(data stored in SCRATCH zone)

EMBL: CP000075.PE320

CP000075.PE320       Location/Qualifiers
FT   CDS_pept        336861..337430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0320"
FT                   /product="Protein of unknown function UPF0149"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35392"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35392.1"
FT                   /translation="MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDSEG
FT                   WFADASMLLETELLETEPQENIRAALVGLQEMVKGELTGDDMTVVLLLPGDDEPLTERA
FT                   AALGQWCQGFLAGFGLSIGDKVLGSEAKAVLEDLAAIAQVQDALEESEDGETDYMEVME
FT                   YMRVAPLLLFTEFNEPSAPQPKPSLH"
     atgcccattc agaattctcc gtacaaagcg ttcgccactc tgctcaatag cggtggccat        60
     aaagtatccc ctgccgaact gcacggcctg ctgttgggcc gcagttgcgc gggtgccggc       120
     ttcgatagcg aaggctggtt cgccgacgcc tcgatgctgc tggaaaccga gctgctggaa       180
     accgagccgc aagaaaacat tcgtgcagcg cttgtcggcc tgcaagagat ggtcaagggc       240
     gaactcaccg gcgatgacat gacggtcgtg ctgttgctgc cgggcgatga tgagccgctc       300
     accgagcgcg ccgccgcgct gggccagtgg tgtcagggtt tcctcgcagg ctttggcctg       360
     tccatcggtg acaaggttct gggcagcgaa gcgaaagccg tgctcgagga cctggctgcc       420
     atcgcgcagg ttcaggacgc gctggaagag tccgaagacg gcgaaaccga ctacatggaa       480
     gtcatggagt acatgcgtgt agcgccgctg ctgctgttca ctgaattcaa cgagccgtcc       540
     gcgccgcaac ccaagccttc cctgcactga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page