(data stored in ACNUC7421 zone)

EMBL: CP000075.PE325

CP000075.PE325       Location/Qualifiers
FT   CDS_pept        343698..345008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0325"
FT                   /product="General substrate transporter:TonB box,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35397"
FT                   /db_xref="GOA:Q4ZZM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35397.1"
FT                   /translation="MKIKGIRWWMVGLVTAGLVVNYLARNTLSVAAPTLMSELSISTEQ
FT                   YAHIVVAWQLCYAIMQPVAGYIIDAIGTKMGFAIFAIAWSAACAAAAFATGWQSLAIFR
FT                   GMLGLTEAAGLPAGVKATTEWFPAKERSVAIGWFNIGSSFGALLAPPLVVWAILQSGWE
FT                   LAFLIVGGLGIVWSGLWLLLYKHPRDQKRLGDAERDYILSGQEARLKDAPAQKGSWKRL
FT                   FKNRNFYAIASARILSEPAWQTFNAWIPLYLMTERHMNIKEVAMFAWLPFLAADIGCVL
FT                   GGYLSPLFHKYCKVSLFTSRKMVMLFGCSCMIGPACIGLVESPYTAIALLCIGGFAHQT
FT                   LSGALYSITSDSFGKNEVATATGMGGMFGFFGAAAFTMVFGVLVTKIGYSPLFVVLAIF
FT                   DIVAAIVVWNVAREVPQYDDTVPLTADEQGPRTVPAT"
     atgaagataa aaggcattcg ttggtggatg gtggggctgg tcacggccgg cctggtggtc        60
     aactacctgg cacgcaacac actgtccgtc gcagctccga cgctcatgag cgagctgagc       120
     atttccaccg agcagtacgc gcacatcgtg gtcgcctggc aactgtgcta cgccatcatg       180
     caacctgtgg cgggctacat cattgatgcg atcggcacca agatgggctt tgcgattttc       240
     gccatcgcct ggtctgccgc ctgcgctgct gccgccttcg caaccggctg gcagagtctg       300
     gcgatcttcc gcggcatgct cggcctgacc gaagccgcag ggctgccggc cggcgtcaag       360
     gcgaccactg aatggtttcc ggccaaggag cgctcggtcg ccatcggctg gttcaacatc       420
     ggttcgtcgt tcggcgcatt gcttgcgccg ccgctggtgg tctgggccat tctgcagagt       480
     ggctgggagc tggcgtttct gattgtcggc ggcctgggca ttgtgtggag cggcctgtgg       540
     ctgctgctgt acaagcaccc gcgcgatcag aagcgtcttg gcgatgccga acgtgactac       600
     atcctcagcg gccaggaagc gcgtctgaag gacgcacctg cccagaaagg cagctggaag       660
     cgactgttca aaaaccgtaa tttctacgcg attgcctcgg cgcgaatcct ctccgagcct       720
     gcctggcaga ccttcaatgc gtggattccg ctgtacctga tgaccgagcg tcacatgaac       780
     atcaaggaag tcgcgatgtt cgcctggctg ccgtttctgg cggctgacat cggctgcgta       840
     ctgggcggct acctgagccc gttgttccac aagtactgca aggtgtcgct gttcacctcg       900
     cgcaagatgg tcatgctgtt cggctgctcc tgcatgatcg ggccagcgtg catcgggctg       960
     gtcgaaagtc cctacaccgc tattgccttg ttgtgcatcg gtggttttgc tcaccagacc      1020
     ctgtcgggcg cgctgtattc gatcacctcg gattcattcg gcaaaaacga ggtggctacg      1080
     gcgaccggga tgggcggaat gttcggcttt ttcggggcgg cggcattcac catggtgttc      1140
     ggcgtgctgg tcaccaaaat tggctacagc ccgctgttcg tggtgctggc gattttcgac      1200
     atcgtcgctg cgattgtggt gtggaacgtt gcccgtgaag tcccgcagta tgacgacaca      1260
     gtgccgttga ctgcggacga gcagggtccg cgtactgtgc ctgcaacctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page