(data stored in ACNUC7421 zone)

EMBL: CP000075.PE326

CP000075.PE326       Location/Qualifiers
FT   CDS_pept        345222..345803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0326"
FT                   /product="Protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35398"
FT                   /db_xref="GOA:Q4ZZM4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35398.1"
FT                   /translation="MHNESIRYLIVPGWQGSPDDHWQTHWQNSLPNSTRVEQADWLKPR
FT                   REDWVGELQRTIAAHDTPVILIAHSLGCVTVAHWARLAPLETLRQVQGALLVAPADVER
FT                   PNCPPALRNFAPIPTDLLPFPTQIVSSDNDPAVSSQRAMEMARHWGAELGFLSQAGHIN
FT                   VKSGHQRWEQGFAYLYRLQNRLEQHARRRA"
     atgcataacg agtcgatccg gtatctgatc gtgccaggct ggcaagggtc tcctgacgat        60
     cattggcaga cccactggca gaacagcctg cccaacagca cgcgcgtgga gcaggccgac       120
     tggctcaagc cacgtcgtga agactgggtg ggtgagttgc aacgcacgat tgccgcgcat       180
     gacacgccag tgatcctgat cgcgcacagc ctgggttgcg tcacggtcgc gcactgggct       240
     cgactcgcgc cgctggaaac cttgcgtcag gtgcagggcg cactgctggt ggcaccggcc       300
     gacgtcgagc gtccgaattg cccgcctgca ttgcgtaatt tcgcgccgat ccctactgat       360
     ctattgccgt ttccgacgca gatcgtcagc tctgacaacg accctgcggt cagctcccag       420
     cgtgccatgg agatggcgcg tcattggggc gccgagctag gttttttgag tcaggccggg       480
     catatcaacg tcaagtccgg ccatcaacgc tgggagcagg gcttcgctta cctgtatcgc       540
     ctgcaaaacc gtctggagca acacgcgcgt cgtcgcgcat ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page