(data stored in ACNUC7421 zone)

EMBL: CP000075.PE333

CP000075.PE333       Location/Qualifiers
FT   CDS_pept        353004..354185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35405"
FT                   /db_xref="GOA:Q4ZZL7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35405.1"
FT                   /translation="MLEPAEQAFQRNVVSLMCQRAVAYLPLWRERAAVAETNRRLSSST
FT                   FDELFTEGWLDLVSPRAPVTRTGHWPTLVESARIAARACASTGWMLALVGGHGSIARRL
FT                   PPACVDQLYSHGPRQLFASASTSTDSLLSFEPEGVRVDGRWRFSSGIEDATWLMLNAPC
FT                   ADHPEAACTPRFLVLVAANEVERLHNWDSCGMAATGSHDVLLRRLLVPHDRVFALHEVF
FT                   AQDPLALACDYIDRLPLVPYLTTSIIGPLLGCAEGALAAFVAAFNSSSAVSDPRIAEQA
FT                   AHSAAQLYSVELLYDSLISRLHEAGLSDRVLDAAQLLQLKRDRAYLAQQCVQAVHRLVE
FT                   RLGASSLVASNPLQRHWRDIQAMAAHRDVTWNETMQACGDAILRPATDNAQKN"
     atgcttgagc ctgccgagca agcgttccag cgtaacgtag tgtccttgat gtgtcagcgg        60
     gcggtcgcgt atctgccttt gtggcgagag cgggctgctg tggccgaaac aaatcgccgg       120
     ctgagcagta gcacattcga cgaactgttt accgaaggct ggctggatct ggtgtcgcca       180
     cgcgcgcctg tcacacgtac gggtcactgg cccactctgg tagaaagcgc acggattgcg       240
     gctcgggcgt gtgcctccac aggctggatg ctggcgttgg tgggtggtca cggctcaatc       300
     gcccggcgac tgccccccgc ctgcgtagac cagctttaca gccatggccc acgacagttg       360
     ttcgcttcag catctaccag taccgatagc ctgctgtcct ttgaaccaga aggtgttcgg       420
     gttgacgggc gctggcgctt cagttcgggc attgaggatg ctacctggtt aatgctcaac       480
     gccccctgcg ctgaccaccc tgaagccgct tgcaccccgc gctttctggt gctggtcgcc       540
     gccaacgaag tggagaggct tcacaattgg gacagctgcg gtatggcggc aaccggttct       600
     cacgacgtgc tgctccggcg gttgttggtg ccgcatgacc gcgtcttcgc gctgcatgaa       660
     gtgtttgcgc aggacccgct tgcattggcg tgcgactaca tcgacaggtt gcccctcgtg       720
     ccctatctga ccacctcgat cattggcccg ctactgggct gtgcagaggg tgctcttgcc       780
     gcgtttgtag cggccttcaa cagttcatcg gcggtaagtg atccccggat cgccgaacag       840
     gctgcacact cggccgcaca gctctacagc gtcgagctgt tgtatgactc gttgatctcc       900
     cggctgcacg aggcgggact cagtgaccgg gttctggacg cagcgcaatt gttgcagctc       960
     aagcgcgacc gcgcctatct ggcgcaacaa tgcgtgcagg ccgtgcaccg gttagtggaa      1020
     aggctcggtg cgtcttcctt ggttgccagt aacccgcttc agcgtcactg gcgtgatatc      1080
     caggcgatgg ccgcgcaccg agacgtgacc tggaacgaaa cgatgcaggc ctgtggcgac      1140
     gcgattctgc ggcctgccac tgacaacgct caaaagaatt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page