(data stored in SCRATCH zone)

EMBL: CP000075.PE341

CP000075.PE341       Location/Qualifiers
FT   CDS_pept        363882..364115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35413.1"
FT                   /translation="MINSTPSPPLPNSLEDSLMQVSDILRCASATAYETGDNLDGLKRD
FT                   LAFSVVHLINMAKAELERSLECVQNPDSPDET"
     atgatcaact caaccccgtc cccgccgctc cccaactctc tggaagactc tctgatgcag        60
     gtcagcgaca tactgcgctg tgcctctgcc accgcgtatg aaaccggtga caacctcgat       120
     ggcctgaaac gcgatctggc gttctcggtg gtgcatctga tcaatatggc caaggccgag       180
     ctggagcgct cgctggaatg tgttcagaac cctgacagcc ctgatgaaac ctag             234
//

If you have problems or comments...

PBIL Back to PBIL home page