(data stored in ACNUC7421 zone)

EMBL: CP000075.PE342

CP000075.PE342       Location/Qualifiers
FT   CDS_pept        364205..365200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35414"
FT                   /db_xref="GOA:Q4ZZK8"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35414.1"
FT                   /translation="MRQQTTPCRYRYDALDRLATRTPVGGSIARSFYQSDTLASEIQDA
FT                   EHLRFLHHDRQLLATQSALATLLIGSDQQHSVLHTVSAGLPAAIAYTPYGHRQALNPLP
FT                   GFNGERPDPLTGHYLLGNGYRAYNPVLMRFNSPDSLSPFGNGGVNAYGYCAGDPVNRSD
FT                   PTGHGLIDDVQTYIYLGTALVTGVFGLLTARSSIKAVIKGVKLDPEANAVDNALSQTSA
FT                   LRRPATTVEKVSAAIGVGALIASATWTASYIAGKFERDSLAARTLRSVAIVVVVPVLGF
FT                   RGWTYYRSRLPARSAKKASMSKRSSTGSDRIRSSRSSIRNDDPEIEITPL"
     atgcgccagc aaaccactcc atgccgctac cgctacgacg cgctggaccg gctcgcgact        60
     cgcacgcctg tgggagggtc cattgcccgt tcgttctatc agtccgacac gctggccagc       120
     gagattcagg atgcagaaca ccttcgcttc ctgcatcacg atcgccagtt gctcgctacg       180
     cagtcagcgc tcgccacgtt gttgatcggc tcggaccaac agcacagcgt gctccacacc       240
     gtatcggccg gcttgcctgc cgctatcgcc tacaccccct atgggcatcg gcaagcgctg       300
     aacccgctgc caggcttcaa cggtgagcga cctgacccgt tgaccggtca ttatctgttg       360
     ggcaatggtt atcgcgccta caaccccgtt ctgatgcgct tcaacagccc tgacagcctg       420
     agtccgtttg gcaacggcgg agtcaatgcg tatggctatt gtgcgggtga cccggtcaat       480
     cgatccgatc ctacgggaca tggactcatt gatgatgtgc agacgtacat ctaccttggc       540
     acagcccttg ttaccggcgt ttttggcctt ctgacggctc gttcgtctat aaaggctgtg       600
     ataaagggag tgaagctgga tcccgaagca aacgctgtcg ataatgccct ctcccagact       660
     tccgcgctca gaagaccggc gaccacggtg gaaaaagtct cggcagccat tggtgtcgga       720
     gcgctgattg ccagtgcgac atggaccgcc tcttatattg caggtaagtt cgagcgtgat       780
     tcactggcag ctcgtacgct gagaagcgtt gctatagttg ttgttgtccc tgtcctcggg       840
     tttcgtggct ggacgtatta tcgttccagg cttccagcgc gatctgcaaa aaaagcttcg       900
     atgtcgaagc ggagctcaac tgggtctgat cgcattagat cctcacgttc aagtattcga       960
     aatgatgatc cagagattga aatcactcct ctttga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page