(data stored in SCRATCH zone)

EMBL: CP000075.PE343

CP000075.PE343       Location/Qualifiers
FT   CDS_pept        365313..366428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35415"
FT                   /db_xref="GOA:Q4ZZK7"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35415.1"
FT                   /translation="MAILCKYTYDPLDRVSTLTPLAQAVANRFYNGEQLMTELQGGRQR
FT                   TCVRAGGQLLAQQLREGDEVVTTMIAGDRNNSVLHASEAGQQSDVVYTPFGHHQAVQAS
FT                   AELPGFNGEQPDPLTGHYLLGNGYRAYNPVLMRFNSPDSMSPFGKGGLNAYAYCVGDPV
FT                   NRVDPTGHFSALAALISGIVLSAAGAGAIATAAGLKDSDSTLGTTLTVVGSISLMAGLG
FT                   AFATTGFKLKQTSVKLKQMRAKIKTGKREASDLASARKQSSARHAEALTRQADELTRHA
FT                   DELKGPPASSDSALTFRLELMEADVMKNGPYDYYSSSFLDPVMLNKIRDKDAKRVVVLD
FT                   STSRPPGLLTLTRIDDGQTLRTKAHAIREIT"
     atggccattc tgtgcaagta cacctacgac ccgctggacc gtgtgtccac attgaccccg        60
     ttggctcagg ccgtcgccaa ccggttctat aacggcgaac aactgatgac cgagttgcag       120
     ggcggcaggc aaagaacctg tgtccgcgca ggcggccagc tgctggcgca acagcttcgg       180
     gagggcgatg aggtcgtgac gacgatgatc gccggcgacc gtaacaatag cgttctgcac       240
     gcgagcgaag ccgggcaaca atctgacgtt gtctatacgc cattcgggca tcatcaagcc       300
     gtgcaggcta gtgcagagct acccggtttc aacggcgagc agcctgaccc gctgaccggc       360
     cattacctgc tcggcaatgg ctatcgcgcc tacaacccgg ttttgatgcg cttcaacagt       420
     cctgacagca tgagcccgtt tggcaagggc gggttgaatg cgtatgcgta ttgtgtgggt       480
     gatccggtca atcgggttga tccgacgggg catttctcgg cgttggctgc tttgatatca       540
     ggcattgtac ttagtgctgc cggagcgggc gcaatagcga cggctgccgg gctcaaggat       600
     tcggacagta cgctcggtac cacgctcacc gtcgtcggga gcatctcttt gatggccggc       660
     ttgggggcat ttgctacgac gggtttcaag ttaaaacaga cgagcgtcaa gttaaaacaa       720
     atgagagcca agattaaaac aggcaagagg gaggcgagtg atttggcgtc cgctagaaaa       780
     caatcgagcg ctcgccatgc tgaggcattg actcgccagg ctgatgaatt gactcgccat       840
     gctgatgaat tgaagggccc ccccgcatct tctgacagtg cacttacgtt tcgattagag       900
     cttatggagg ccgacgtcat gaagaacggt ccttacgatt actattcttc cagctttctt       960
     gacccggtta tgctcaataa aatacgagat aaagatgcga aacgcgttgt agtacttgat      1020
     tcgactagta ggccccctgg tttactgact ttgacgcgta tcgatgatgg tcagacgctt      1080
     cgcactaaag cacacgcgat cagggagata acgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page