(data stored in SCRATCH zone)

EMBL: CP000075.PE344

CP000075.PE344       Location/Qualifiers
FT   CDS_pept        366781..367899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0344"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35416"
FT                   /db_xref="GOA:Q4ZZK6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35416.1"
FT                   /translation="MPVRISRLVTFGLAAALAALAGCGEEKPAAPELPRVYVQTVKSAD
FT                   FAASVALTGDVQARVQTRLSFRVNGKIIQRNVDVGDRVTARQVLARLDPKDLQTNVDSA
FT                   AAAVAAEQARVSQSRAAFVRQQKLLPKGYTSRSEYDSAQAAVRGSESSLKAAQAQLANA
FT                   REQLGYTALVADAPGVITARQAEVGQVVQATMPIFDLARDGDRDAVFNVYESLFVQPPT
FT                   NQAVQVTLLDNPNIKVSGKVREVTPAVSAQTGTLQIKIALDPLPEGMDLGSVVSVALSA
FT                   PANASVELPWAALTKDLGEQLGKPAVWVVDEQGKVNLRKVTVTRYLTSKVIIGDGLKSG
FT                   EKVVVAGGQLLHPDMQVDIAEQPKPQNAQVQP"
     atgcccgttc gtatttcaag actggttacg ttcggtctgg ccgctgcctt ggcggcgctg        60
     gcgggctgtg gcgaggaaaa accggcggcg cccgaactgc ccagggttta cgtgcagacg       120
     gtaaaaagtg ccgacttcgc cgccagtgtc gccctgaccg gtgatgttca ggcgcgggtg       180
     cagacccgcc tgtctttccg ggtcaatggc aagatcattc agcgtaacgt cgatgtgggc       240
     gaccgggtca ctgcccggca ggtgctggcg cggctcgatc cgaaggatct gcagaccaat       300
     gtcgattcgg ccgctgctgc tgtggcggcc gaacaggccc gcgtgagcca gtcccgcgct       360
     gcgtttgtcc gtcagcaaaa gctgctgccc aagggttata ccagtcgcag cgaatatgac       420
     tcggcccagg ccgccgtgcg tggcagcgag agttcgttga aagcggcgca ggcgcaactg       480
     gccaatgctc gcgagcaact gggttatacc gctctggtcg ctgacgcgcc gggtgtgatc       540
     accgcgcgtc aggctgaagt cgggcaagtg gtgcaggcca ccatgccgat tttcgatctg       600
     gcgcgcgacg gtgatcgcga tgcggtgttc aatgtctacg agtcgctgtt cgttcagccg       660
     ccgaccaatc aggccgtgca ggtcacgttg ctcgataacc cgaacatcaa ggtcagcggc       720
     aaagtgcgcg aagtaacccc ggcggtgtcg gcgcagaccg gtaccttgca gatcaagatt       780
     gccctggacc cgctgcctga aggcatggac ctgggctcgg tggtcagcgt ggcgctgagc       840
     gcaccggcca acgccagtgt cgagttgcca tgggcggcgc tgaccaagga cctcggcgaa       900
     cagttgggca agcctgccgt atgggtggtg gacgagcagg gcaaggtcaa tctgcgcaag       960
     gtcaccgtta cccgttacct gacgtccaaa gtcatcattg gcgacgggct caagagtgga      1020
     gagaaagttg tggtggcagg cggacagttg ttacacccgg acatgcaggt cgacattgcc      1080
     gaacagccca aaccacagaa tgcacaggtg cagccatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page