(data stored in ACNUC7421 zone)

EMBL: CP000075.PE345

CP000075.PE345       Location/Qualifiers
FT   CDS_pept        367896..368981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0345"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35417"
FT                   /db_xref="GOA:Q4ZZK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35417.1"
FT                   /translation="MKRRSCLLLGSLLLSGVLLSGCGKDEAPPEPVRPVVFVEVRPESN
FT                   QDFGRFAGNIQARYQSVLGFRVAGRIARRDVDVGAEVKKGDLLATLDPTDQQNTVRARQ
FT                   GDLANVQAQLINAQANARRQQELFDRGVGAQAQLDIALTDLKTASSSQEQAKAAAQQAR
FT                   DQLSYSELRSDHDAVVTEWKVEAGQVVTAGQEVVTLAQPDIKEAVIDLPDTLADQLPSD
FT                   VVFTVASQLNPEVNTTATIREIEPQADRTTRTRRARLSLAQTPAAFRLGTAISVTLSST
FT                   ITPRMRLPINALQEVDGKRQVWIVDSQSQTVNPRAVTIASRDSDSFVLTDGVKAGEKVV
FT                   SAGVNSLKPGQKVKVDEESPR"
     atgaagcgtc ggtcatgtct gttgctgggc agcctgctgt taagcggcgt tttattgagt        60
     ggctgtggca aggatgaagc acctcccgag ccggtgcgtc ccgtcgtgtt tgtcgaagtc       120
     cggcctgagt cgaatcagga tttcgggcgt ttcgccggca atatccaggc gcgttatcaa       180
     agtgtgctgg gctttcgtgt cgcggggcgc attgcccggc gcgatgttga cgtaggcgct       240
     gaagtcaaga aaggcgactt gctggcaacc ctcgatccga ccgatcagca gaacacggtg       300
     cgtgcccggc agggcgacct ggccaatgtt caggcgcagt tgatcaacgc ccaggccaat       360
     gctcgccgcc agcaggagct gttcgatcgc ggcgtcggtg cccaggcgca actggacatc       420
     gccctgaccg acctgaagac cgccagctcg tcgcaggaac aggccaaggc cgcggctcaa       480
     caggcccgcg atcaattgag ttacagcgag ctgcgcagtg atcacgatgc ggtggttacc       540
     gagtggaaag tcgaagccgg acaggtggtg acagccggtc aggaagtcgt gaccctggcg       600
     cagccggaca tcaaggaagc ggtgatcgac ctgcccgata cattggccga ccagttaccg       660
     tccgacgtgg tattcaccgt cgccagtcag ctcaatccgg aagtgaacac caccgccacc       720
     attcgcgaaa tcgagcccca ggccgaccgc accacacgta cgcgacgtgc gcgtctgtcg       780
     ctggcgcaaa cgccagcggc gttccggctg ggcacggcca tcagcgtaac gctcagctcg       840
     accatcacgc cgcgcatgcg tctgccgatc aatgccctgc aggaagtcga tggcaaacgc       900
     caggtctgga tcgtcgactc gcagagccag acggtgaacc ccagagcggt gactattgcc       960
     agccgtgaca gcgactcctt cgtgctgacc gatggcgtca aagccggtga aaaagtggtg      1020
     agcgcgggcg tcaacagcct caagccgggc cagaaagtca aagtcgatga ggaaagcccg      1080
     cgatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page