(data stored in ACNUC7421 zone)

EMBL: CP000075.PE348

CP000075.PE348       Location/Qualifiers
FT   CDS_pept        complement(372774..373400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35420"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35420.1"
FT                   /translation="MKLDPQTLAQITAATLGNYNSVADDFRAGTRDHDVSQNIDALLRH
FT                   IEGPTPWQILDFGCGPGRDLKAFTAMGHVAVGLDGSERFAEMARAETGCEVVQQNFLEL
FT                   DLPQGRFDGLFANAVLFHIPKQELPRVLRQLHATLKPGGVLFSSNPRGENQEGWNGERY
FT                   GAYHDLESWRKLLTEAGFVELEHYYRPAGLPREQQPWLASVWRRQ"
     atgaaactcg acccacagac ccttgcgcag atcaccgccg cgaccctcgg caactacaac        60
     agcgtggccg acgacttccg cgcaggcacc cgcgaccacg acgtcagcca gaatatcgac       120
     gcgctgctgc gccatatcga aggaccgacg ccctggcaga ttctcgactt cggctgcggg       180
     ccggggcgtg atctgaaggc gtttaccgcg atgggccatg tggcggtcgg gctcgacggc       240
     tccgaacgtt tcgcagagat ggcccgcgcc gagaccggct gcgaagtggt gcagcaaaac       300
     ttcctcgaac tcgacctgcc gcaaggccgc ttcgatggcc tcttcgccaa tgcagtgtta       360
     ttccacatcc ccaaacagga gctgccgcgc gtcctgcgtc agttgcatgc cacgctcaaa       420
     ccgggcggcg tgctgttcag ctccaatccg cgcggtgaga atcaggaagg ctggaacggc       480
     gaacgttacg gcgcttatca cgacctggaa tcatggcgaa aattgctgac cgaagccggc       540
     tttgtcgaac tggagcacta ctaccgtccc gccgggctgc cgagggagca gcaaccatgg       600
     ctggcaagtg tctggcggcg tcagtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page