(data stored in ACNUC7421 zone)

EMBL: CP000075.PE355

CP000075.PE355       Location/Qualifiers
FT   CDS_pept        complement(380690..381409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35427.1"
FT                   /translation="MSQNTCKASPMSLPIPAVPLASRHGIGVRNASQLVVHVDPYGSME
FT                   EGDLIELFWDGCYVASTILKASDVGKPVVLRVPESFLQNGKARTYYRVMKIGGVPVTSP
FT                   CRKLWVKLDAPGGLLVSASTEENQGLAPLYVAPSVIRHGLSRRHLEGGLPMTIEPYLNM
FT                   AVHDEITIRWGDLRMDLPPLTADDIGEPVDLVVPPELIREGGDEQRLEVSYCVIDRVGN
FT                   NSLWAPPRIIRIQPLGH"
     atgagtcaaa acacttgcaa agccagccct atgagcttgc cgatccctgc tgttccgctg        60
     gccagccgac atggcatagg cgtgaggaac gcctctcaac tcgtcgttca tgtggacccc       120
     tacggcagca tggaagaggg cgatctgatc gaactgtttt gggacggctg ttacgtcgcg       180
     tcaacaattt tgaaggcatc tgacgtcggc aagcctgtcg tcctacgtgt gccggaaagc       240
     tttctgcaga atggcaaggc gagaacctac taccgggtca tgaagatcgg cggagtgccc       300
     gtcacctcgc cctgccgcaa gctatgggtc aagctggacg ccccgggagg gctgctggtc       360
     agcgccagca cggaagaaaa ccaggggctg gcgccgctct atgttgcgcc atcggtcata       420
     cgccacggcc tgtcgcgcag acacctggaa ggcggcttgc cgatgaccat cgagccttat       480
     ctgaacatgg ctgttcacga cgagatcacc atacgttggg gcgatctgcg catggacctg       540
     ccgccgctca ccgccgacga tatcggtgag ccggtcgatt tggttgtacc gcctgagttg       600
     atacgcgaag gcggagacga gcaacgtctg gaagtgagtt actgtgtgat cgaccgggta       660
     ggcaacaact cgctctgggc accaccccgt ataataagga tccaaccgct ggggcattga       720
//

If you have problems or comments...

PBIL Back to PBIL home page