(data stored in ACNUC7421 zone)

EMBL: CP000075.PE357

CP000075.PE357       Location/Qualifiers
FT   CDS_pept        complement(382734..383402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0357"
FT                   /product="Diaminopimelate ABC transporter membrane protein
FT                   / L-cystine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35429"
FT                   /db_xref="GOA:Q4ZZJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35429.1"
FT                   /translation="MIEESLQLALDSAPFLLKGAYYTVFLSLGGMFFGLLLGFGLALMR
FT                   LSRIKPVNWIARIYVSFFRGTPLLVQLFVIYYGLPELGIQLEPLSAALIGFSLNMAAYA
FT                   CEILRAAISSVERGQWEAAASIGMTRWQTMRRAILPQAARTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEIFTMYLAAALIYWILATALSHLQNKLEARVNRHDLET
FT                   "
     atgattgaag agagccttca gctcgcgctg gactccgcgc ccttcctgct caagggcgcg        60
     tactacacgg tattcctcag tcttggcggg atgtttttcg gtttgctgct gggcttcggc       120
     ctggcattga tgcgcctttc gcgcatcaaa ccggtgaact ggatagcacg catctacgtg       180
     tcgttctttc gcggcacgcc cttgctggtg cagctgttcg tgatttatta cggcctgccg       240
     gagctgggta tccagcttga gccgctgagc gctgcactga tcggtttttc cctgaatatg       300
     gccgcctacg cctgtgaaat cctgcgcgcg gccatcagtt ccgtggagcg cggccagtgg       360
     gaggcagcgg ccagtatcgg catgacccgc tggcagacca tgcgtcgggc gatcctcccg       420
     caggccgcac gcaccgcatt gccgccgctg ggcaacagct tcatctcgct ggtcaaggac       480
     acggcgctgg cagccaccat ccaggtgcca gagctgttcc gtcaggcgca gttgatcacc       540
     gcacgcacct tcgaaatttt caccatgtac ctggccgctg cactgatcta ctggatcctt       600
     gccacggcgc tctcgcacct gcaaaacaag ctggaagcca gggtcaaccg gcacgatctg       660
     gagacctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page