(data stored in ACNUC7421 zone)

EMBL: CP000075.PE361

CP000075.PE361       Location/Qualifiers
FT   CDS_pept        complement(386578..387285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35433"
FT                   /db_xref="GOA:Q4ZZI9"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35433.1"
FT                   /translation="MTRPLDDNIHELAGEYVLGTLSGQKRLDVQRRLSREPDLRAAVDA
FT                   WEQRLQPLTGLAEPVTPSPGLWDRIERNLLDMAAPASTPQRPRVRWWDNLSIWRGLAGA
FT                   GLAASLVLGMTLLTRAPAQPSYLVVLVGPQDKAPGWVVQASNSQEIQLIPLGVFEVPTD
FT                   KALEFWTKGDDWQGPVSLGLVKPGQSLHVPLDKLPPLQPNQLFELTLEKSTGSPIGKPT
FT                   GPIQFIGRAVKVI"
     atgacccggc ctttagacga caacattcac gagctggctg gcgagtatgt actcggcacc        60
     ctctcggggc agaagcggct cgacgtacag cgtcgcctgt cgcgcgagcc cgacctgcgg       120
     gccgccgtcg atgcctggga acagcgtctg cagcccctga ccggactggc cgaaccggta       180
     acgccctcgc ctggcctgtg ggatcgcatc gaacgtaacc tgctggacat ggccgcgcct       240
     gccagcacgc cgcaacgacc gcgcgtgcgc tggtgggaca acctgtcgat ctggcgcggc       300
     ctcgccgggg ccggcctggc tgcttcgctg gtattgggca tgacgctgct gacccgcgca       360
     ccggcgcaac cgtcgtatct ggtggttctc gtagggccgc aggacaaggc gcctggctgg       420
     gtcgtgcagg ccagtaattc gcaggaaata cagcttatcc cgctgggcgt gttcgaggtt       480
     ccgaccgaca aggcactgga gttctggacc aagggtgacg actggcaagg cccggtttcg       540
     cttgggctgg tcaaaccggg gcaaagcctg catgtgccgc tggataaact gccgccgctg       600
     caacccaacc agttgttcga gctgacactg gagaaatcca ccggctcgcc catcggcaaa       660
     cccaccgggc cgattcagtt catcggccgg gcggtgaagg tgatctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page