(data stored in ACNUC7421 zone)

EMBL: CP000075.PE363

CP000075.PE363       Location/Qualifiers
FT   CDS_pept        complement(387952..388485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35435"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35435.1"
FT                   /translation="MNAKRLLCLAGTTLAFTCLSSVAMAQTDLPESVRVPAGNKVGMQT
FT                   TGVGEITYECRAKANMPNEMEWAFVGPKAVLNDKSGKQVGTYYGPPATWEAKDGSKITG
FT                   TQVAVAPSSTGNLPYQLVKANPAEGKGAMTGVTYIQRVALKGGVAPAKACAESNKGAKE
FT                   VVKYQADYLFWTAG"
     atgaacgcaa aacgcttgct ctgccttgct ggtaccactc tggccttcac ttgcctgtcg        60
     tctgttgcca tggctcagac cgacctcccc gaaagcgtcc gtgtgccggc tggcaacaag       120
     gtcggcatgc aaaccaccgg ggttggcgag atcacctacg agtgccgcgc caaggccaac       180
     atgcccaacg aaatggagtg ggcgttcgtc ggccccaaag cagtgctcaa cgacaagagc       240
     ggcaaacagg tcggcaccta ctacggcccg cctgctacct gggaagccaa agacggttcc       300
     aaaataaccg gcactcaagt cgccgtggcc ccgtcgagca ctggcaacct gccgtatcag       360
     ctggtcaagg ccaacccggc tgaaggcaag ggcgcaatga ccggcgtcac gtacattcag       420
     cgtgtagccc tgaaaggcgg cgttgccccg gccaaagcct gcgcagagag caacaagggc       480
     gcgaaggaag tggtcaagta tcaggctgat tacctgttct ggactgccgg ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page