(data stored in ACNUC7421 zone)

EMBL: CP000075.PE365

CP000075.PE365       Location/Qualifiers
FT   CDS_pept        complement(389816..390412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0365"
FT                   /product="protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35437"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35437.1"
FT                   /translation="MSQTRILRAADYPRMPWKNGGGSTEEIARDAGQDLDGFGWRLSIA
FT                   DIETSGGFSVFAGYQRIITVLQGAGMTLDVDGLSSRPLLPSDPFAFSGDSQVNCTLMDG
FT                   PIRDFNLIYAPHRYTARLHWIDVRHPQRLFSSASTLVLFSMAEQVAISVDSQPWEILGK
FT                   HDCAQVDNAGGLLEVELQSPRASRCCLIELTATGQ"
     atgagccaga cccgcatttt gcgcgccgca gactacccgc gcatgccgtg gaagaacggc        60
     ggaggcagca ctgaagagat cgctcgcgac gcaggccagg acctggacgg tttcggctgg       120
     cggctgtcga ttgccgacat cgaaacctcg ggcggttttt cggtgttcgc cggttatcag       180
     cgcatcatca ccgtcctgca gggcgcgggc atgacgctgg acgtggatgg cctcagcagt       240
     cgcccgctgc tgccatcgga cccgtttgca ttcagcggtg acagtcaggt caattgcacc       300
     ttgatggacg ggccgattcg cgatttcaac ctgatctacg ccccacaccg ctacactgca       360
     cgcttgcact ggatagacgt gcgtcacccg caacgcctgt tcagttcagc cagtactctg       420
     gtgctgttca gcatggccga gcaagtggcg atcagcgtcg acagtcagcc gtgggaaatc       480
     ctcggcaaac acgattgcgc tcaggtggac aacgctggcg gtctgcttga agtcgaactg       540
     caatcaccgc gcgccagccg ttgctgcctg atcgagctta ccgccacagg ccagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page