(data stored in SCRATCH zone)

EMBL: CP000075.PE37

CP000075.PE37        Location/Qualifiers
FT   CDS_pept        40756..40971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0037"
FT                   /product="Protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35111"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35111.1"
FT                   /translation="MSDHHTYKKVEIVGSSTTTIEDAINNALAEASKSLDLMEWFEVTE
FT                   TRGHIENGKVAHFQVTLKVGFRITNS"
     atgtccgatc atcacacgta caagaaagtt gaaatcgtcg gctcttccac gaccaccatc        60
     gaagacgcca tcaacaatgc cctggccgaa gccagcaaaa gcctcgacct gatggaatgg       120
     tttgaagtga ccgaaacccg cggccacatc gaaaacggca aagtcgcgca cttccaggta       180
     acgttgaaag tgggcttccg catcaccaac agctaa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page