(data stored in ACNUC7421 zone)

EMBL: CP000075.PE377

CP000075.PE377       Location/Qualifiers
FT   CDS_pept        402055..403983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0377"
FT                   /product="Periplasmic glucan biosynthesis protein, MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35447"
FT                   /db_xref="GOA:Q4ZZH5"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35447.1"
FT                   /translation="MIVSPCDAPKTPVKRLRSALLASSALVCLFSAGQLWAFNLDDVAA
FT                   KAKEMAGQKFEAPRSNLPNELRDMKFADYQKIRFRDDKAEWAGEKTPFKVSFYHQGMHF
FT                   DTPVKINEVTATSVDEIKYDPNRFDFGDLKIDPKSTEKLGYAGFRVLYPINKDDKQDEI
FT                   MTMLGASYFRVIGKGQVYGLSARGMAIDTASPSGEEFPRFKEFWIEKPGPDDNHLVIFA
FT                   LLDSPRATGAYQLTLRPGTNTLVDVKSRMFLRDKVNKLGVAPLTSMFLFGANQPSRVPN
FT                   YRRELHDSSGLSIQAANGEWLWRPLNNPKHLSISSFSVENPRGFGLLQRGRDFSQYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVELVEIPTADETNDNIVAYWKPETLAEPGQEMAFDYR
FT                   LHWTMQENSIHSPDLGWVKQTQRSIGDVRQSNLIRQPDGSLAFLVDFVGPVLAALPEDK
FT                   TIRSQVTTDDNVELVENNLRYNPVTKGYRLTLRVKVKDSSKPTEMRAYLLREIPAEPGK
FT                   EPALLVADKAEEKKAAAKEAAKPAVSKESANDQVEIAKADAPKPEAAKPETAKSEAGKA
FT                   DAAKGKGEVAKADAGKADASKAEAAKDKDGKEIQQPETEAAPTHPEPAKTLQVMTETWS
FT                   YQLPSDE"
     gtgattgtta gtccctgtga tgctccaaag acacctgtca agcggttgcg tagtgcactt        60
     ctggcaagct cggcccttgt atgcctgttc agtgcaggtc agctgtgggc gttcaacctt       120
     gatgatgtag cggcgaaggc caaagaaatg gccgggcaga agttcgaggc tccgcggagc       180
     aatctgccga acgagctgcg cgacatgaag ttcgccgatt atcagaagat ccgcttccgt       240
     gatgacaagg ccgaatgggc gggtgaaaag actccgttca aagtgtcttt ctaccaccag       300
     ggcatgcact tcgatacgcc ggtcaagatc aacgaagtga ccgcgaccag cgtcgacgag       360
     atcaagtacg acccgaatcg ttttgacttc ggcgatctga agatcgaccc gaaatccacc       420
     gagaaactgg gttatgccgg tttccgtgtc ctgtatccga tcaacaagga tgacaagcag       480
     gacgaaatca tgaccatgct gggcgcgagc tacttccgcg tcatcggcaa gggtcaggtt       540
     tatggccttt ccgcgcgcgg catggcgatc gacactgcct cgccatccgg tgaagaattt       600
     ccgcgcttca aggaattctg gatcgagaag ccaggcccgg atgacaacca tctggtgatc       660
     tttgctctgc tcgactcgcc gcgtgccacc ggtgcctatc agttgaccct gcgtccgggt       720
     accaacaccc tggttgacgt gaagtcgcgc atgttcctgc gtgacaaggt caacaagctt       780
     ggcgttgctc ctctgaccag tatgttcctg ttcggcgcca accagccttc gcgtgtgcct       840
     aactaccgtc gtgaactgca cgattccagc ggtctgtcga ttcaggcggc caacggtgag       900
     tggctgtggc gtccgctgaa caaccctaaa catctgtcca tcagcagctt ctcggtcgag       960
     aacccgcgtg gtttcggtct gctgcaacgt ggccgcgact tcagccagta cgaagacctg      1020
     gatgaccgct acgacaagcg tccaagtgcc tggatcgagc cgaagggcga ttggggtaaa      1080
     gggactgtcg agctggtcga aattccgact gccgacgaga ccaacgacaa catcgtagct      1140
     tactggaagc ctgaaacgct ggccgagcct ggtcaggaaa tggcgttcga ctaccgtctg      1200
     cactggacca tgcaggaaaa ctcgattcac tcgccggatc tgggctgggt caagcagact      1260
     caacgctcca tcggtgacgt gcgtcagtcc aacctgatcc gtcagccgga cggcagcctt      1320
     gccttcctgg tcgacttcgt gggcccggtg ctggccgcac tgccggaaga caagaccatt      1380
     cgcagccagg tgaccactga cgacaacgtc gagctggtgg aaaacaacct gcgctacaac      1440
     ccggtcacca aaggttaccg cctgaccctg cgtgtcaagg tcaaggattc cagcaagccg      1500
     accgaaatgc gcgcctacct gttgcgtgaa atccctgccg aaccgggcaa ggaacctgcg      1560
     ctgctcgtgg ctgacaaagc cgaagagaag aaggctgccg cgaaggaagc tgccaagccg      1620
     gcagtctcca aggagtccgc caacgaccag gtagaaatcg ccaaggccga cgcacccaag      1680
     ccggaagctg ccaagcctga gactgccaag tccgaagctg gcaaggctga cgcagccaaa      1740
     ggcaaaggcg aagtcgccaa ggccgatgca ggcaaagccg acgcatccaa ggctgaagca      1800
     gccaaggata aggacggtaa ggaaattcag cagcctgaaa ccgaggcagc acccacccat      1860
     ccggaaccgg ccaagacgtt gcaagtcatg accgagacct ggagctatca gttgccgagc      1920
     gatgagtaa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page