(data stored in ACNUC7421 zone)

EMBL: CP000075.PE38

CP000075.PE38        Location/Qualifiers
FT   CDS_pept        41122..41346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0038"
FT                   /product="Protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35112"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35112.1"
FT                   /translation="MKKFLLAVGLLSIAGTALAAGKPCEELKSELDARLQAKGVTSYTL
FT                   EVVEKGSAADKQVVGTCEGGTKEIVYQRG"
     atgaagaagt ttttgttggc tgtaggcttg ctgagcattg caggcactgc cctcgcggca        60
     ggcaagccat gtgaagagtt gaaaagtgaa ctcgacgcaa gactccaggc gaagggcgta       120
     acgtcctaca cgctggaagt ggtcgagaaa ggcagcgcgg ccgacaagca agtcgtcggc       180
     acctgcgaag gcggcaccaa ggaaatcgtt taccagcgcg gttga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page