(data stored in ACNUC7421 zone)

EMBL: CP000075.PE388

CP000075.PE388       Location/Qualifiers
FT   CDS_pept        complement(416964..417587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0388"
FT                   /product="Protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35458"
FT                   /db_xref="GOA:Q4ZZG4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35458.1"
FT                   /translation="MLLRGLLASIEHGINRVLRLDSTALPRMARLSGRVIAVDCRDPSL
FT                   KLFILPSDQGLLLAADWAAEADCTLRAPASSLVRLSLSKDKTAVLHGPDVELDGDSGAL
FT                   LELVGILQDLELDWEHELSNWIGPVASQLFSSHLRNSGRWTRESFNSLSQNVTDYLSEE
FT                   SRTLVGKHEAEARFAELDQIKLDLERLEARFARLAHSLNTSDNA"
     atgttgctcc gggggctgct cgccagcatc gagcacggca tcaatcgggt gctgcgcctg        60
     gacagcaccg cgctgccccg catggcgcgt ctgtccggac gtgtcattgc ggtggactgt       120
     cgcgatccgt ccctgaagct gttcatcctg cccagcgacc aaggcttgct gctcgccgct       180
     gactgggctg ccgaagccga ctgcaccctg cgtgcgccgg cgtccagcct ggtgcgtctg       240
     tccctgagca aagacaagac cgctgtgctg cacggcccgg acgtcgaact cgacggtgac       300
     agcggcgcgc tgctggaact ggtcggcatt cttcaggacc tggaactgga ctgggagcac       360
     gaactgtcca actggatcgg cccggtggcc agccagttgt tcagcagcca cctgcgcaac       420
     agtgggcgct ggacgcggga aagcttcaac agcctcagcc agaacgtcac cgactacctc       480
     agcgaagaat cgcgcacgct ggtaggcaaa cacgaagccg aagcacgatt cgccgaactc       540
     gatcagatca aactcgatct ggaacgcctc gaggcgcgct ttgcccgcct tgcccactcc       600
     ctcaatacca gcgataacgc atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page