(data stored in ACNUC7421 zone)

EMBL: CP000075.PE393

CP000075.PE393       Location/Qualifiers
FT   CDS_pept        complement(420148..420519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0393"
FT                   /product="Protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35463"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35463.1"
FT                   /translation="MLPTAIQLHKASKTLTLKYAPDEEYHLPAEFLRVHSPSAEVQGHG
FT                   RPILQFGKLGVGLTKVEPAGQYALKLTFDDGHDSGLFTWEYLYELATRQASLWEDYLQE
FT                   LEKSGKSRDPSEHVIKLML"
     atgctcccaa ccgccatcca actgcataaa gcctccaaga ccctgacgct gaaatacgcg        60
     ccggatgagg aataccattt gcccgccgaa tttctgcggg tgcattcccc ttctgccgaa       120
     gttcagggcc acggccggcc gatcctgcaa ttcggcaaac tgggagtcgg cctgaccaag       180
     gtcgagcccg ccgggcaata tgcgctgaaa ctcactttcg atgacggcca tgacagcggc       240
     ctgtttacct gggaatacct gtacgaactg gccacacggc aggcttcgct gtgggaagac       300
     tacctgcagg aactcgaaaa atccggcaag tcccgcgacc cttccgaaca cgtcatcaaa       360
     ctgatgctct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page