(data stored in ACNUC7421 zone)

EMBL: CP000075.PE394

CP000075.PE394       Location/Qualifiers
FT   CDS_pept        complement(420627..421964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0394"
FT                   /product="Heat shock protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35464"
FT                   /db_xref="GOA:Q4ZZF8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35464.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKLLREQEIVKVRHRAEDAAEERILDALLPPARVGFNEDPAQSSDSNTRQLFRKRLR
FT                   EGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKL
FT                   VREEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLP
FT                   LIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFER
FT                   ILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLER
FT                   LLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL"
     atgtcaatga ctccccgcga aatcgtccat gaactcaacc gccatattat cggccaggac        60
     gatgccaagc gcgccgtggc cattgccctg cgcaatcgct ggcgccgcat gcagttgccg       120
     gaagagctgc gtgttgaagt aacccccaag aacattctga tgatcggtcc gaccggtgtc       180
     ggcaaaaccg aaatcgcccg tcgtctggcc aaactcgcca acgcgccgtt catcaaggtc       240
     gaagccacca aattcaccga agttggttat gtgggtcgtg atgtagagtc gatcatccgt       300
     gatctggccg atgccgcgat caagctgctg cgcgaacagg aaatcgtcaa ggtgcgtcac       360
     cgtgccgaag atgctgccga agagcgcatt ctcgacgccc tgctgccacc ggcccgggtc       420
     ggcttcaacg aagacccggc gcagagcagc gattccaata cccgtcagct gttccgcaag       480
     cgtctgcgcg aaggccagct ggatgataag gaaatcgaga tcgagatcaa cgaagccgtt       540
     ggtgtcgata tctccgcgcc gcctggcatg gaggagatga ccaatcagtt gcagagcctg       600
     tttgccaaca tgggcaaggg caagaccaag agccgcaaac tcaaggtcaa ggaagcgctc       660
     aagctggtac gcgaagaaga agcgggccgt ctggtcaatg aagaagagct gaaagccaag       720
     gcgctggaag cggtcgaaca acacggcatc gtgttcatcg acgaaatcga caaggtggcc       780
     aagcgtggta attcgggcgg tgtcgacgtg tcccgtgaag gcgtgcagcg cgacctgctg       840
     ccactgatcg aaggctgcac cgtgaacacc aaactgggca tggtcaagac cgaccatatc       900
     ctgtttatcg cctcgggcgc gttccatttg agcaagccga gtgatctggt ccccgagctg       960
     caaggccgtc tgccgatccg cgtcgaactc aaggcgctgt cgccgcagga cttcgagcgc      1020
     atcctcagcg agccgcatgc gtcgttgacc gaacagtacc gcgagctgct caagaccgaa      1080
     ggcctgaaga tcgagttcaa gcctgaaggc atcaagcgtc tggccgagat cgcctggcag      1140
     gtcaacgaga agaccgagaa catcggcgcc cgccgcctgc acacgctgct tgagcgcctg      1200
     ctcgaggaag tctcgttcag cgccggtgac ctggccatca gccctgacgc agcgccgatc      1260
     gagatcgacg cggaatacgt caatagtcac ttgggtgacc tggcagaaaa cgaagacctg      1320
     tcgcgttata ttctctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page