(data stored in SCRATCH zone)

EMBL: CP000075.PE396

CP000075.PE396       Location/Qualifiers
FT   CDS_pept        complement(422977..423672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0396"
FT                   /product="Sporulation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35466"
FT                   /db_xref="GOA:Q4ZZF6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35466.1"
FT                   /translation="MAVAKKKPAPKRGASRYQAPAKKPIPGWLWLAIGLTVGAFVVFLM
FT                   KLEPGGDDVKRVRADAKAAKIAEANKTPPSPTAPVKPKYDFYTLLPESEVIVPNEAVPE
FT                   KTPPPVAPTAPVSPEQAAKIDTARAQAALSGLTPPPAPPVATTKPAAVTTFFLQAGSFR
FT                   KQADAEKVRAQIILLGQTSTVESGTVKDETWYRVLVGPFSNREQLTTAQKQLASGGFSN
FT                   LLLQQRQSR"
     ttggcagttg cgaagaagaa accggcaccc aagcggggcg ccagccgtta ccaggcaccc        60
     gcgaagaagc cgattccagg atggttgtgg ctggcgattg gcttgaccgt gggcgcattc       120
     gtggtctttt tgatgaagct cgaacccggt ggcgatgacg tcaagcgggt cagggcagac       180
     gccaaggctg caaagatcgc cgaagcgaac aagacaccgc caagccctac ggcgccggtc       240
     aaacccaagt acgacttcta cacattgctg ccggaatcgg aagtgatcgt gccgaacgag       300
     gccgtgccgg aaaaaacccc gcctcctgtg gcaccgacag caccggtctc gccggaacag       360
     gcagccaaga tcgacacggc acgcgcccag gcagccctca gcggcctgac gcctccgccg       420
     gcgccaccgg ttgcgaccac caagccggca gcggtgacga cgttcttcct gcaggcgggc       480
     tcgttccgca aacaggctga cgccgagaaa gtccgcgcgc aaatcatcct gctgggccag       540
     acctctaccg tcgagtcggg caccgtcaag gatgaaacct ggtatcgcgt actggtcggc       600
     ccgttcagca accgcgaaca actgaccact gcccagaaac aactggcaag cggcggattt       660
     agtaacctgt tgttgcaaca gcgccagagc cgctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page