(data stored in ACNUC7421 zone)

EMBL: CP000075.PE4

CP000075.PE4         Location/Qualifiers
FT   CDS_pept        3809..6226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35078"
FT                   /db_xref="GOA:Q500U4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35078.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSELLLLTVRRSGKIWEQTYVHGVPQEPMKIVGESD
FT                   STGTQIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTPVNEVFHFNIQRDDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLSESAPGI
FT                   SGTALEKLVNDFRMVMKTLKRLSRLYPQELTEHFVYLPPITLEQLSDHEGMQAWLALFD
FT                   ARLRTGEKSGLVYKASLREDRERNVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVTAL
FT                   GAQISTLLEEGAYVQRGERKKPVNEFKEALAWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
     atgagcgaaa accaaacgta cgactcgtcc agcattaaag tgctgaaagg acttgatgcc        60
     gtacgcaagc gtcccggaat gtacatcggt gatacagacg atggcagcgg tctgcaccac       120
     atggtgttcg aggtggttga taactcgatc gacgaagcat tggcaggcca ttgcgacgac       180
     atcagcatca tcatccaccc agacgaatct atcaccgtgc gcgacaacgg ccgcggtatt       240
     ccggtagacg tgcataaaga agaaggcgtg tcggcagccg aggtcatcat gaccgtgctc       300
     cacgctggcg gtaagttcga tgacaactcc tacaaagtat ccggtggttt gcacggcgta       360
     ggtgtctctg tagttaacgc cctttcagag cttctgttgc tgacggttcg tcgtagcggc       420
     aagatctggg aacagaccta tgttcatggt gttccacagg aaccgatgaa gatcgtcggt       480
     gaaagtgaca gcacaggcac tcagatccac ttcaagcctt cagctgaaac gttcaagaac       540
     atccacttca gctgggacat tctggccaag cggattcgtg aactgtcttt cctgaactcc       600
     ggtgtcggca ttgtcctcaa ggatgagcgc agcggtaagg aagaattgtt caaatacgaa       660
     ggcggtctgc gcgcattcgt tgagtacctg aacaccaata aaacgccggt caacgaagtg       720
     ttccacttca acatccagcg tgatgacggt atcggtgtcg agattgctct gcagtggaac       780
     gatagcttca acgagaacct gctgtgcttc accaacaaca ttccgcagcg tgatggcggt       840
     actcacctgg tgggcttccg ctctgcgctg acgcgtaacc tgaacaacta catcgagcag       900
     gaaggtctgg ccaagaagca caaggtcgcg accaccggcg atgacgcgcg tgaaggtctg       960
     actgcgatca tttcggtcaa ggtgcctgat cctaagttca gctcgcagac caaggacaag      1020
     ctggtttcgt ccgaagtcaa aacggctgtc gaacaggaaa tgggcaagta cttctccgac      1080
     ttcctgttgg aaaacccgaa cgaagccaaa gcggttgtcg gcaagatgat cgacgcagcc      1140
     cgtgcccgcg aagctgcgcg caaggcgcgc gagatgaccc gtcgtaaagg cgcgctggat      1200
     atcgctggcc tgccgggcaa actggcggac tgccaggaaa aagaccctgc cctctccgaa      1260
     ctgtacctgg tggaagggga ctctgctggc ggatcagcca agcaggggcg taatcgtaga      1320
     actcaggcca tcctgccgct caagggcaag atcctgaacg ttgaaaaagc gcgtttcgac      1380
     aagatgatct cttcgcagga agtgggcacc ttgatcactg cgctgggctg cggtattggc      1440
     cgtgaagagt acaacatcga caagttgcgt tatcacaaca tcatcatcat gaccgatgct      1500
     gacgtcgacg gctcgcacat ccgtaccctg ctgctgacct tcttcttccg tcagttgccc      1560
     gagctgatcg agcgtggcta catctacatc gctcagccgc cgctgtacaa ggtcaagaaa      1620
     ggcaagcagg agcagtacat caaggacgac gaggccatgg aagaatacat gacccagtcg      1680
     gcccttgaag acgccagcct gcacctcagc gaatcggcgc cgggtatctc cggtaccgca      1740
     ctggagaagc tggtcaacga cttccgcatg gtcatgaaga cgctcaagcg cctgtcgcgt      1800
     ctgtacccac aggaactgac cgagcacttc gtctacctgc cgccgatcac gctcgaacaa      1860
     ctgtcggatc acgagggcat gcaagcctgg ctggcactgt tcgacgcgcg tctgcgcacc      1920
     ggcgagaagt caggtctggt ctacaaggcc agcctgcgtg aagaccgtga acgtaacgtc      1980
     tggctgccag aggtcgaact gatctcccac ggcctgtcga actacgtcac cttcaaccgc      2040
     gacttcttcg gcagcaacga ctacaagacc gttaccgctc tgggcgcgca gatcagcacg      2100
     ctgctggaag aaggtgccta cgtacaacgt ggcgagcgca agaagcccgt caacgagttc      2160
     aaggaagccc tcgcctggtt gatggccgaa agcaccaagc gccacaccat ccagcgctac      2220
     aaaggtctgg gtgagatgaa cccggaccag ctgtgggaaa ccaccatgga cccgagtgtg      2280
     cgccgcatgc tgaaagtcac catcgaagat gccatcggcg ctgaccagat cttcaacacc      2340
     ctcatgggtg atgcggtcga gcctcgccgt gacttcatcg agagcaatgc gctggccgtg      2400
     tccaacctgg acttctga                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page