(data stored in ACNUC7421 zone)

EMBL: CP000075.PE407

CP000075.PE407       Location/Qualifiers
FT   CDS_pept        436404..438560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0407"
FT                   /product="type II and III secretion system
FT                   protein:NolW-like protein:NolW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35477"
FT                   /db_xref="GOA:Q4ZZE5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35477.1"
FT                   /translation="MKWARPSMHSSAQRKLIMTRILSIIGVSLCIAMLSPVLQAANLKT
FT                   LDVAALPGDRIELKLAFDAPVPAPRGYTTSQPARIALDLPGVTSQLATKSRDLGTGNAR
FT                   SVVVVQAQDRTRVIINLTTLSPYSSRVDGNNLFVVIGQGAGAAQASQPTTAMGAQRVAV
FT                   PPPTPASAKPFIPAGVKAIRNVDFQRGELGEGNVVIDLSNPSIAPDIQEQGGKIRVDFA
FT                   KTQLPEPLRVRLDVKDFATPVQFVSASATGDKASILIEPSGAFDYSAFQTENKLTISVR
FT                   PLTNEDLDRRAADKPVYTGEKLSLNFQDIDVRSVLQLIADFTNLNLVASDTVQGGITLR
FT                   LQNVPWDQALDLVLKTKGLDKRKVGNVLLVAPADEIAARERQELESLKQIAELAPLRRE
FT                   LLQVNYAKAADIAKLFQSVTSAESKADERGSITVDDRTNNIIAYQTQERLDELRRIVSQ
FT                   LDIPVRQVMIEARIVEANVDYNKQLGVRWGGSTNTSGSGKWTTYGLDNNGDEAGNTSGN
FT                   LTPNVPFVDLGAAGATSGIGLGFVTNNTLLDLELSAMEKTGNGEIVSQPKVVTSDKETA
FT                   KILKGTEIPYQESSSSGATTVSFKEASLSLEVTPQITPDNRIIMEVKVTKDEPDYLNAV
FT                   LGVPPIKKNEVNAKVLISDGETIVIGGVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVS
FT                   ESKSELLVFLTPRIMNNQAISVSR"
     atgaagtggg caaggccaag tatgcacagt agcgctcaac ggaaattgat catgacccgg        60
     attctctcga ttatcggcgt gtcgttatgc atcgcgatgc tgtcgccggt tctccaggct       120
     gccaacctca agaccctgga tgtcgccgcc ctgccgggtg accgcatcga gctgaagctg       180
     gcattcgacg ccccggtgcc tgcaccgcgc ggttacacca cctcgcaacc ggcgcgcatt       240
     gcgctggacc tgccgggtgt taccagccag ctggcgacca aaagtcgtga cctgggcacc       300
     ggcaatgcgc gcagtgtggt cgtggtacag gctcaggacc gtacccgggt gatcatcaac       360
     ctgaccacgc tttcgccgta cagctcccgc gtcgatggca acaacctgtt cgtggtcatc       420
     ggccagggtg ccggcgccgc gcaagcctcc cagccgacta ccgcgatggg cgcgcaacgg       480
     gtcgcggtgc caccgcccac accggcatcc gccaagccgt tcatccccgc tggcgtcaag       540
     gccatcagga atgtcgactt tcagcgtggc gagctgggtg aaggcaatgt ggtcattgac       600
     ctgagcaacc ccagcattgc cccggatatt caggagcagg gcggcaagat ccgcgtggac       660
     ttcgccaaga cccagctgcc cgaaccgctg cgcgtccgcc tggacgtcaa ggacttcgcc       720
     acgccggtgc agttcgtcag tgcttcggcg acaggtgaca aggccagcat tctgatcgag       780
     ccgtcgggcg ccttcgacta ctcggcgttc cagaccgaaa acaagctgac gatcagcgtg       840
     cgcccgttga ccaacgagga tctggaccgc cgcgctgccg acaagccggt gtacaccggt       900
     gaaaagctgt cgctgaactt ccaggacatc gatgtgcgtt cggtgctgca gctgattgcc       960
     gacttcacca acctcaatct ggtggccagt gatacggtcc agggcggtat caccctgcgt      1020
     ctgcagaatg tgccatggga tcaggcgctg gatctggtgc tgaaaaccaa gggcctggac      1080
     aagcgcaagg ttggcaacgt tctgctggtc gcaccagccg atgaaattgc cgcccgtgag      1140
     cgtcaggagc tggaatcgct caaacagatc gccgagctgg cgcccctgcg ccgcgaactg      1200
     ctgcaggtca attacgccaa ggcagccgac atcgccaagc tgttccagtc cgtgaccagc      1260
     gccgagtcca aggccgacga gcgcggctcg atcacggtgg acgaccggac caacaacatc      1320
     attgcctacc agacccagga acgactcgac gaactgcgtc gtatcgtgtc gcaactggac      1380
     atcccggtac gccaggtgat gatcgaggcg cgcatcgtcg aggccaacgt cgattacaac      1440
     aagcagctcg gggtacgctg gggcgggtct accaacacca gcggcagcgg aaaatggaca      1500
     acctacgggc ttgacaataa tggcgacgag gccggtaaca ccagcggcaa cctgaccccc      1560
     aacgtgccgt tcgtggacct cggcgcagcc ggcgctacct cgggtatcgg ccttggcttc      1620
     gtgaccaaca acacgctgct ggaccttgag ctgagtgcca tggagaaaac cggtaacggt      1680
     gaaatcgtct cccagcccaa ggtggtgacc tccgacaagg aaaccgccaa gatcctcaag      1740
     ggcacggaga tcccgtatca ggaatccagc tccagcggtg cgaccaccgt gagcttcaag      1800
     gaagcttccc tgtcgcttga agtgacgccg cagatcacgc cggacaaccg catcatcatg      1860
     gaagtgaagg tcaccaagga cgagccggac tacctgaatg cggtactggg cgtaccgccc      1920
     atcaagaaga acgaggtcaa cgccaaggtg ctgatttccg acggcgaaac catcgtcatc      1980
     ggtggtgtgt tctcgaatac gcaaagtaaa gttgtcgata aagtgccatt tcttggcgat      2040
     gtaccgtatc ttggccggct tttcaggcgc gatgtggtat ccgagtccaa atccgagctg      2100
     ttggtatttt tgactccgcg tatcatgaac aaccaggcga tttctgtgag tcgttga         2157
//

If you have problems or comments...

PBIL Back to PBIL home page