(data stored in SCRATCH zone)

EMBL: CP000075.PE410

CP000075.PE410       Location/Qualifiers
FT   CDS_pept        440312..441934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35480"
FT                   /db_xref="GOA:Q4ZZE2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35480.1"
FT                   /translation="MTSLHADEAFLGHYQLSHDPFAARVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLAVTGPQGSGKTLLRQALVASTNKQSVQSVVISARGAGDAAGVLQQVAQALS
FT                   VAQAEMQSILSQVVQLGLTGQEVYLLVDDAEQLGDSALEALLGLAAGTPEGRPHVFLFG
FT                   EPSLLDRLDQMCADLQGDVEGERFHVIELQPYTEEETREYLAQRLEGAGQGIALFTADQ
FT                   ITDIHEQSDGWPGAINQVARDSMIEAMIASRSAVKRPSVGFKMPKKHVLALGAVVIVAV
FT                   AAAVLIPGRGDKTGTPANAPASAQAQLPLGEGKPTAQQSNNGSPAIEFAGNSQPMPLPM
FT                   NGNQPVMRGPLAEAAGSSDSDEDAVPTGSPAQPPTVTTTAPPAGVPAGQAAAQTPRSSI
FT                   PAPTPAPAPAAKPAPAQTQVATAKPAPAPAAKPAEKPAAAAAKPAAGGSWYSSQAPGHY
FT                   VVQILGTSSEATAQAYVAEQGGEYRYFKKTLQGKPLYVVTYGNFPDRAAALAAIKVLPA
FT                   KVQAGKPWPRTVASVQQELGATR"
     atgactagtt tgcatgccga cgaggccttc ctcggccatt atcagttgag tcatgacccc        60
     tttgcggcgc gggtacctgg cttcaaattc tttcctgccc aacgcaagcc tgtgctgggt       120
     cagcttcatc atctggcgcg ctacagccag ttgctgctgg cggtcaccgg gcctcagggc       180
     agcggcaaga ccctgctgcg tcaggcgttg gtggcgagta ccaacaagca gtcggtgcaa       240
     agtgtcgtga tttctgcgcg cggtgccggc gatgctgcgg gcgtgctgca gcaggtcgcg       300
     caggcgctga gcgtcgccca ggctgaaatg cagtcgatcc tgtcgcaggt cgtgcagctc       360
     gggctgaccg gtcaggaagt ctacctgctg gttgacgatg cggaacaact tggcgattcg       420
     gcgctcgaag cgttgctggg tcttgctgcg ggaacgcctg aagggcgtcc gcatgtattc       480
     ctgttcggag agccatcgct gctcgatcgt ctcgatcaga tgtgtgccga cctgcagggc       540
     gatgtcgaag gcgaacgctt tcacgtcatc gagctgcaac cctatacgga agaggaaacc       600
     cgggagtatc tggctcagcg tctggagggt gcagggcagg gaatcgcgtt gttcaccgcc       660
     gaccagatca ccgatattca tgaacagtcc gatggctggc ctggcgcaat caaccaggta       720
     gcccgcgatt caatgatcga ggcgatgatc gcgagtcgtt ccgcggtcaa gcgtccaagt       780
     gtggggttca aaatgccgaa aaaacacgta ttggccttgg gtgccgttgt catagtggcc       840
     gtggcagcag ccgtgctgat cccgggtcgc ggcgacaaga cgggtacacc cgccaatgcc       900
     ccggcttccg ctcaggcgca actgccgctg ggcgaaggca agccaactgc tcaacaatcg       960
     aacaacggca gcccggccat cgaattcgct ggcaattccc agccgatgcc gttgccgatg      1020
     aatggcaacc agccggtgat gcgcggtcct ctggccgaag ccgccggttc cagtgattcc      1080
     gacgaagacg ccgtgccgac aggttcgcct gcccagccgc cgaccgtgac cactactgcg      1140
     cctccagccg gtgttccggc aggtcaggcc gcagcgcaga cgcctcgttc gtccatccct      1200
     gcgccgacac ctgcacctgc gccagcggcc aagccggcac ctgcgcagac tcaggttgct      1260
     acggccaagc ctgccccggc tccggctgcc aaaccggctg aaaaaccggc agcggccgcc      1320
     gccaaaccgg ctgccggcgg tagctggtac agcagccagg caccaggcca ctacgtggtg      1380
     cagattctcg gcaccagctc cgaagcgacg gcccaggcct acgttgcaga gcagggtggc      1440
     gagtatcgtt atttcaagaa aaccctgcag ggcaagccgt tgtacgttgt gacgtacggc      1500
     aactttcctg accgcgctgc cgccctggca gccatcaagg tattgccagc caaggttcag      1560
     gctggtaaac cttggcctcg tactgtcgcc agcgtccaac aagagctcgg cgccactcgt      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page